KEGG   Mus musculus (mouse): 170744
Entry
170744            CDS       T01002                                 

Gene name
Tlr8
Definition
(RefSeq) toll-like receptor 8
  KO
K10170  toll-like receptor 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    170744 (Tlr8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170744 (Tlr8)
   04090 CD molecules [BR:mmu04090]
    170744 (Tlr8)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   170744 (Tlr8)
CD molecules [BR:mmu04090]
 Proteins
  170744 (Tlr8)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_5 TIR_2 LRR_1
Other DBs
NCBI-GeneID: 170744
NCBI-ProteinID: NP_573475
MGI: 2176887
Ensembl: ENSMUSG00000040522
Vega: OTTMUSG00000019575
UniProt: P58682
Position
X; X F5
AA seq 1032 aa
MENMPPQSWILTCFCLLSSGTSAIFHKANYSRSYPCDEIRHNSLVIAECNHRQLHEVPQT
IGKYVTNIDLSDNAITHITKESFQKLQNLTKIDLNHNAKQQHPNENKNGMNITEGALLSL
RNLTVLLLEDNQLYTIPAGLPESLKELSLIQNNIFQVTKNNTFGLRNLERLYLGWNCYFK
CNQTFKVEDGAFKNLIHLKVLSLSFNNLFYVPPKLPSSLRKLFLSNAKIMNITQEDFKGL
ENLTLLDLSGNCPRCYNAPFPCTPCKENSSIHIHPLAFQSLTQLLYLNLSSTSLRTIPST
WFENLSNLKELHLEFNYLVQEIASGAFLTKLPSLQILDLSFNFQYKEYLQFINISSNFSK
LRSLKKLHLRGYVFRELKKKHFEHLQSLPNLATINLGINFIEKIDFKAFQNFSKLDVIYL
SGNRIASVLDGTDYSSWRNRLRKPLSTDDDEFDPHVNFYHSTKPLIKPQCTAYGKALDLS
LNNIFIIGKSQFEGFQDIACLNLSFNANTQVFNGTEFSSMPHIKYLDLTNNRLDFDDNNA
FSDLHDLEVLDLSHNAHYFSIAGVTHRLGFIQNLINLRVLNLSHNGIYTLTEESELKSIS
LKELVFSGNRLDRLWNANDGKYWSIFKSLQNLIRLDLSYNNLQQIPNGAFLNLPQSLQEL
LISGNKLRFFNWTLLQYFPHLHLLDLSRNELYFLPNCLSKFAHSLETLLLSHNHFSHLPS
GFLSEARNLVHLDLSFNTIKMINKSSLQTKMKTNLSILELHGNYFDCTCDISDFRSWLDE
NLNITIPKLVNVICSNPGDQKSKSIMSLDLTTCVSDTTAAVLFFLTFLTTSMVMLAALVH
HLFYWDVWFIYHMCSAKLKGYRTSSTSQTFYDAYISYDTKDASVTDWVINELRYHLEESE
DKSVLLCLEERDWDPGLPIIDNLMQSINQSKKTIFVLTKKYAKSWNFKTAFYLALQRLMD
ENMDVIIFILLEPVLQYSQYLRLRQRICKSSILQWPNNPKAENLFWQSLKNVVLTENDSR
YDDLYIDSIRQY
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggaaaacatgccccctcagtcatggattctgacgtgcttttgtctgctgtcctctgga
accagtgccatcttccataaagcgaactattccagaagctatccttgtgacgagataagg
cacaactcccttgtgattgcagaatgcaaccatcgtcaactgcatgaagttccccaaact
ataggcaagtatgtgacaaacatagacttgtcagacaatgccattacacatataacgaaa
gagtcctttcaaaagctgcaaaacctcactaaaatcgatctgaaccacaatgccaaacaa
cagcacccaaatgaaaataaaaatggtatgaatattacagaaggggcacttctcagccta
agaaatctaacagttttactgctggaagacaaccagttatatactatacctgctgggttg
cctgagtctttgaaagaacttagcctaattcaaaacaatatatttcaggtaactaaaaac
aacacttttgggcttaggaacttggaaagactctatttgggctggaactgctattttaaa
tgtaatcaaacctttaaggtagaagatggggcatttaaaaatcttatacacttgaaggta
ctctcattatctttcaataaccttttctatgtgccccccaaactaccaagttctctaagg
aaactttttctgagtaatgccaaaatcatgaacatcactcaggaagacttcaaaggactg
gaaaatttaacattactagatctgagtggaaactgtccaaggtgttacaatgctccattt
ccttgcacaccttgcaaggaaaactcatccatccacatacatcctctggcttttcaaagt
ctcacccaacttctctatctaaacctttccagcacttccctcaggacgattccttctacc
tggtttgaaaatctgtcaaatctgaaggaactccatcttgaattcaactatttagttcaa
gaaattgcctcgggggcatttttaacaaaactacccagtttacaaatccttgatttgtcc
ttcaactttcaatataaggaatatttacaatttattaatatttcctcaaatttctctaag
cttcgttctctcaagaagttgcacttaagaggctatgtgttccgagaacttaaaaagaag
catttcgagcatctccagagtcttccaaacttggcaaccatcaacttgggcattaacttt
attgagaaaattgatttcaaagctttccagaatttttccaaactcgacgttatctattta
tcaggaaatcgcatagcatctgtattagatggtacagattattcctcttggcgaaatcgt
cttcggaaacctctctcaacagacgatgatgagtttgatccacacgtgaatttttaccat
agcaccaaacctttaataaagccacagtgtactgcttatggcaaggccttggatttaagt
ttgaacaatattttcattattgggaaaagccaatttgaaggttttcaggatatcgcctgc
ttaaatctgtccttcaatgccaatactcaagtgtttaatggcacagaattctcctccatg
ccccacattaaatatttggatttaaccaacaacagactagactttgatgataacaatgct
ttcagtgatcttcacgatctagaagtgctggacctgagccacaatgcacactatttcagt
atagcaggggtaacgcaccgtctaggatttatccagaacttaataaacctcagggtgtta
aacctgagccacaatggcatttacaccctcacagaggaaagtgagctgaaaagcatctca
ctgaaagaattggttttcagtggaaatcgtcttgaccgtttgtggaatgcaaatgatggc
aaatactggtccatttttaaaagtctccagaatttgatacgcctggacttatcatacaat
aaccttcaacaaatcccaaatggagcattcctcaatttgcctcagagcctccaagagtta
cttatcagtggtaacaaattacgtttctttaattggacattactccagtattttcctcac
cttcacttgctggatttatcgagaaatgagctgtattttctacccaattgcctatctaag
tttgcacattccctggagacactgctactgagccataatcatttctctcacctaccctct
ggcttcctctccgaagccaggaatctggtgcacctggatctaagtttcaacacaataaag
atgatcaataaatcctccctgcaaaccaagatgaaaacgaacttgtctattctggagcta
catgggaactattttgactgcacgtgtgacataagtgattttcgaagctggctagatgaa
aatctgaatatcacaattcctaaattggtaaatgttatatgttccaatcctggggatcaa
aaatcaaagagtatcatgagcctagatctcacgacttgtgtatcggataccactgcagct
gtcctgtttttcctcacattccttaccacctccatggttatgttggctgctctggttcac
cacctgttttactgggatgtttggtttatctatcacatgtgctctgctaagttaaaaggc
tacaggacttcatccacatcccaaactttctatgatgcttatatttcttatgacaccaaa
gatgcatctgttactgactgggtaatcaatgaactgcgctaccaccttgaagagagtgaa
gacaaaagtgtcctcctttgtttagaggagagggattgggatccaggattacccatcatt
gataacctcatgcagagcataaaccagagcaagaaaacaatctttgttttaaccaagaaa
tatgccaagagctggaactttaaaacagctttctacttggccttgcagaggctaatggat
gagaacatggatgtgattattttcatcctcctggaaccagtgttacagtactcacagtac
ctgaggcttcggcagaggatctgtaagagctccatcctccagtggcccaacaatcccaaa
gcagaaaacttgttttggcaaagtctgaaaaatgtggtcttgactgaaaatgattcacgg
tatgacgatttgtacattgattccattaggcaatactag

DBGET integrated database retrieval system