KEGG   Mus musculus (mouse): 170745
Entry
170745            CDS       T01002                                 

Gene name
Xpnpep2, 9030008G12Rik, mAPP
Definition
(RefSeq) X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound
  KO
K14208  Xaa-Pro aminopeptidase 2 [EC:3.4.11.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    170745 (Xpnpep2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    170745 (Xpnpep2)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    170745 (Xpnpep2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     170745 (Xpnpep2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M24
   170745 (Xpnpep2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  170745 (Xpnpep2)
SSDB
Motif
Pfam: Creatinase_N_2 Peptidase_M24 Peptidase_M24_C Creatinase_N
Other DBs
NCBI-GeneID: 170745
NCBI-ProteinID: NP_573476
MGI: 2180001
Ensembl: ENSMUSG00000037005
Vega: OTTMUSG00000017507
UniProt: B1AVD1
Position
X; X A5
AA seq 674 aa
MAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTMRLAALRQQ
METWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAVWTDSRYWTQ
AERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYDQGFQDSSRHL
LSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEHHAKTPTGVLLS
ALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSRFSLETLQYLNTNCTLPMCV
QLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKEKLVTDTYSPVMLIKAVKNSK
EQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRRNENFSSGPSFETIS
ASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYT
RVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQ
YNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVEAKTKYPGDYLTFELVSFVPYDRNL
IDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLSARAPHIISWTS
LWVASALAILSWSS
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggcccaagcctactggcagtgctacccctggcttgttctcctctgtgcatgtgcctgg
agctacccagagcccaagtaccttggaagggaagatgtgagaaactgttcaaccagccct
gagcgcctgccagttactgccgtcaatacaacaatgcggcttgcagccctccgccaacag
atggagacctggaatctctctgcctacatcatcccagacacggatgcacacatgagtgag
tacattggcaaacctgataagaggcgagagtggatttcaggcttcacagggtctgcaggt
actgctgtggtgaccatggggaaagcagctgtctggaccgatagtcgttactggactcag
gccgaaaggcagatggactgcaactgggagctgcacaaggaagttagcatttcttccatt
gtcgcctggatcttagctgaagtccctgatggacagaacgtgggcttcgaccccttcctc
ttttctgttgattcctggaaaaattatgatcaaggattccaagactccagcagacacctg
ttatcggttacaaccaaccttgttgacgtggcatgggggtcagagaggcccccagtgcca
agccaacccatttatgccctgccgaaagaatttacagggagcacttggcaggaaaaagta
tccgctgtccgaagctatatggagcaccatgccaagactccaactggggtccttctatct
gcacttgatgagacagcctggctcttcaaccttcgtagcagtgacatcccctataacccc
ttcttctactcctatgcactgctcacgaactcctccatcaggttgtttgtcaacaagagt
cgctttagccttgagaccttgcagtacctgaatacaaactgcacattacccatgtgtgtg
caacttgaggactacagtcaagttcgtgacagtgtgaaggcctatgcctcaggcgatgtg
aaaatcttaattggggtcagctataccacctatggggtctatgaagtgatacccaaggag
aaactcgtgacagacacctactccccagtgatgttaatcaaggctgtgaagaacagcaag
gagcaggcccttttgaagagcagccacgtgcgggacgctgtggctgtgatccagtacttg
gtctggttggagaagaacgtgcccaaaggcacggtggatgagttttctggggcagaatac
attgatgagttacgacggaatgaaaacttctcctctggacccagttttgaaaccatctct
gctagtggcctgaatgccgccctggcccattacagcccaacaaaagagctgcaccgtaag
ctgtcctcagatgagatgtacctggtggattctggggggcaatactgggatgggaccaca
gatatcaccagaacagtacattggggcactcctactgccttccaaaaggaggcctatact
cgagtgctaatgggaaacatcgatctgtccagacttgtctttcctgctgctacatcaggg
agagtgatagaagcctttgcccgaagagccttatgggaagttgggctcaattatggtcat
gggacaggccatggcattggcaacttcctctgtgtgcatgagtggccagtgggattccag
tataacaacattgccatggccaagggcatgttcacttccattgaacctggatactaccat
gatggggagtttggaatccgtcttgaagatgtcgcccttgtggtagaagcaaaaaccaag
tacccaggggactacctgacttttgaattggtgtcctttgtgccctatgaccgaaacctc
atcgatgtcaggctgctgtccccagagcagctccagtacctgaaccgctactatcagacc
attcgtgagaatgtaggcccagagctgcagcgtcgccagctgctggaggagtttgcatgg
ttggagcagcacacggagcccctgtcagccagggcccctcatatcatctcctggacctct
ctgtgggtggcctctgcccttgccatcctcagctggagtagctag

DBGET integrated database retrieval system