KEGG   Mus musculus (mouse): 170749Help
Entry
170749            CDS       T01002                                 

Gene name
Mtmr4, AA596759, ESTM44, FYVE-DSP2, ZFYVE11, mKIAA0647
Definition
(RefSeq) myotubularin related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    170749 (Mtmr4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    170749 (Mtmr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    170749 (Mtmr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    170749 (Mtmr4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     170749 (Mtmr4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     170749 (Mtmr4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     170749 (Mtmr4)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    170749 (Mtmr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 170749
NCBI-ProteinID: NP_573478
MGI: 2180699
Ensembl: ENSMUSG00000018401
Vega: OTTMUSG00000001293
UniProt: Q91XS1
Position
11; 11 C
AA seq 1190 aa AA seqDB search
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRATDALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRASGGSLSTGTNDASEACDTDFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVLFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPGSDVVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHSQEVRGSLEPWHSSPEGAETVIDS
GVGSPQLTVGEMGLPPPLPSSQKEYLSNKPFKGHKSCSLSYKLLNTSVSWEMKSNTSDIK
VLEETEALAPDPSAQEEQGRTSDGLGKPPEQFLEKEAVSSLCSVSSKCGGACDFPEPPQD
PLTGTPQQPHLDSMQISPSRCTPDHSQGSLCNPPSVASQTPEPNTDLLSQDPPGSTASIS
HQEQPSSVPDLIYKKEDAGKRGSKNGQLLENPRFGKMPLELARKPISQSQISEFSFLGSN
WDSFQGMMTSFPSGETTPRRLLAYGCCSKRPSNKHIRAAGPCLGGQWAQREGMKSPVCSS
HSNGHCTGPGGKNNRMWFSSHPKQVSSTKPSLLSCPSPVPPLYLDDDGLPFPTDVIQHRL
RQIEAGYRQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSDTEDFG
SDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCFNCDCEFWLAKRRHHCRNCGNVFCA
GCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggagggcccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactggtgaaggaggaggagaatcttcaggtacccttcacagtgctgcagggtgag
ggagtggaattcctgggccgggcaaccgatgccctcattgccatctctaactaccggctg
cacatcaagttcaaagactctgtcatcaacgtgcccctccggatgattgacagtgtggaa
agccgtgatatgtttcagttgcacattgcctgcaaggactccaaagtggtgaggtgccac
ttctctactttcaagcagtgccaagagtggctctcaaggctaagccgggccacagcgaga
cctgccaagcccgaggatctctttgcctttgcctaccatgcgtggtgcctggggctgacc
gaggaggaccagcatacccacctgtgccagccaggagagcacatccgatgtcgacaggag
gcagagctcgcaaggatgggttttgacctgcagaatgtctggagagtctcgcatatcaac
agcaattacaagctgtgccctagttacccccagaagctgctggttcctgtgtggatcaca
gataaagagctggagaacgtggcttctttccgctcttggaaacgcatccctgttgtggta
tacagacacctgcgcaacggggctgccattgctcgctgcagccagcctgagatcagctgg
tggggctggcgcaatgctgatgatgaatacctcgtcacgtccattgccaaagcctgcgcc
ttagacccagggacaagggccagtgggggctccctcagcactgggactaatgatgccagt
gaggcatgtgacacagatttcgattcttctctgactgcatgctctggggtggagagcaca
gcagccccacagaaactgctgatcctggatgcacggtcctacacagcagccgtggctaac
cgggccaagggtggaggctgtgaatgtgaagaatactatccgaactgtgaggtcttgttt
atgggaatggccaacatccacgccatccggaatagcttccagtacctccgggctgtgtgt
agccagatgccagatcccagcaactggttgtcggcactggagagtaccaaatggctgcag
cacttgtcagtgatgctaaaagcagctgtgttggtagccaatacggtagatcgggaaggc
cggcctgtgctggtacactgctctgacggctgggaccgtacaccacagattgtagccctg
gccaaaatactactggatccatattacaggactctggagggcttccaagtgttagtggag
tctgattggctggatttcggacacaagtttggagaccgctgtggccatcaggaaaatgca
gaggaccaaaatgaacagtgtcctgtgttcctccagtggcttgattccgtgcatcagctg
cttaagcagttcccctgcctgtttgagttcaatgaagcatttctggtaaagctggtgcag
cacacatactcgtgtctctacggcacattcctggccaacaacccctgcgagcgagagaag
cgcaacatctataaacggacgtgctctgtgtgggcactcctgcgagctggcaacaagaac
tttcataacttcctctatacacctggttcagacgtggtcctgcatcctgtgtgtcatgtc
cgggccctgcacctctggacagctgtttatctgcctgcgtcatctccatgcacccttgga
gaggaaaatatggatctttacctttccccagtggctcagagccaggaattttctggtcgt
tctctggacaggttacctaaaaccagatccatggatgatctgctctctgcctgtgataca
agcagccccctcactcgtacttccagcgaccctaacctgaataaccactctcaggaggtc
agaggcagcctggagccctggcacagcagtcctgaaggagcagagacagtcatagactct
ggagttggaagcccacagctgactgtgggagaaatgggccttcctcctcctctgcccagt
agccagaaagagtacttgagcaataaacctttcaagggtcataaaagttgttctcttagt
tataagttgcttaatacttctgtgtcctgggaaatgaagagcaacacctctgacatcaag
gtcctggaagaaactgaagcactggccccggacccttcagcccaagaggagcagggtagg
acttctgatggcttagggaagccacctgaacagtttctagagaaggaagctgtcagctca
ctctgcagtgtctctagcaagtgtggtggagcctgtgattttcctgagcctccccaggac
cccctaacaggtactccccaacagccccacctagactccatgcagatctcgccctcaagg
tgcactccagatcacagtcagggcagcctttgcaacccaccaagtgtggccagccaaact
ccagagccaaatactgacctcctcagccaagatccccctggttctacggcaagtatctcc
caccaggaacagcctagctctgtgccggatctgatctacaagaaggaggatgctggcaag
agaggaagtaagaatgggcagctgttggaaaatcctcgctttggaaaaatgccattggag
ttggcccgaaagccaatttctcagagccagatcagtgagttctcatttttagggtcaaac
tgggacagcttccaagggatgatgacttcattcccaagcggagagaccactcctcggcgc
ctgcttgcttatggctgttgtagcaagaggccgagcaataagcatattcgagctgcaggg
ccctgccttgggggccagtgggctcagagagaagggatgaaatctcctgtctgttctagt
cattccaatggacactgcacaggcccaggagggaagaacaaccggatgtggttttccagt
catccgaagcaagtctccagcacaaagccttctcttctgagctgcccttccccagtgcct
cctctctacctggatgatgatggactcccctttcccacggatgtgatccaacacaggtta
cggcagatcgaagcagggtacaggcaagaggtggaacagctacggcgacaggttcgagag
cttcagatgaggctagacattcgtcattgctgtgcccctccagcagaaccccccatggac
tatgaggatgactttacgtgtttaaaggagtcagatggcagtgacactgaagactttggc
tctgatcacagtgaagactgcctttcagaagcaagctgggaacccgttgataagaaggag
actgaggtgactcgctgggttccagaccatatggcatcccactgctttaactgtgactgt
gaattctggttggccaaacgaagacatcattgcagaaattgtgggaacgtattttgtgct
ggatgctgccaccttaagctgcccattcctgatcagcaactctatgacccagttctcgtc
tgtaactcatgttatgaacacattcaagtatctcgtgccagggaactcatgagccaacat
ctgaagaaacccattgctacggcttccagttga

DBGET integrated database retrieval system