KEGG   Mus musculus (mouse): 170753Help
Entry
170753            CDS       T01002                                 

Gene name
Zfp704, C030026M03, C030034L19Rik, Gig1, Znf704
Definition
(RefSeq) zinc finger protein 704
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 170753
NCBI-ProteinID: NP_573481
MGI: 2180715
Ensembl: ENSMUSG00000040209
Vega: OTTMUSG00000051452
UniProt: Q9ERQ3
Position
3; 3 A1
AA seq 566 aa AA seqDB search
MQARRLAKRPSLGSRRGGAAPAPAPEAAALGLPPPGPSPAAAPGSWRPPLPPPRGTGPSR
AAAASSPVLLLLGEEDEDEEGAGRRRRTRGRVTEKPRGVAEEEDDDEEEDEEVVVEVVDG
DEDDEDAEERFVPLGPGRALPKGPARGAVKVGSFKREMTFTFQSEDFRRDSSKKPSHHLF
PLAMEEDVRTADTKKTSRVLDQEKETRSVCLLEQKRKVVSSNIDVPPARKSSEELDMDKV
TAAMVLTSLSTSPLVRSPPVRPNEGLSGSWKEGAPSSSSSSGYWSWSAPSDQSNPSTPSP
PLSADSFKPFRSPAPPDDGIDEADASNLLFDEPIPRKRKNSMKVMFKCLWKSCGKVLNTA
AGIQKHIRAVHLGRVGESDCSDGEEDFYYTEIKLNTDATAEGLNTVAPVSPSQSLASAPA
FPIPDSSRTETPCAKTDTKLVTPLSRSAPTTLYLVHTDHAYQATPPVTIPGSAKFTPNGS
SFSISWQSPPVTFTGVPVSPPHHPTAGSGEQRQHAHTALSSPPRGTVTLRKPRGEGKKCR
KVYGMENRDMWCTACRWKKACQRFID
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaggcgcctggccaagcgccccagcctgggcagccgccgcgggggcgctgcg
cccgctcccgcccccgaggccgccgctctggggctcccgccccccggccccagcccggcc
gccgcaccgggaagctggaggccgccgctgccgccgccgcgcgggaccggcccctcgcgc
gctgccgccgcctcgtcgccggtcctgctgctgctgggcgaggaggacgaggacgaggag
ggcgcgggccgaaggcgcaggacgcgcgggcgggtaacggagaagccccgaggggtcgcg
gaggaggaggacgacgacgaggaagaggacgaagaggtggttgtcgaggtggtggacggc
gacgaggacgacgaggacgctgaggagcgcttcgtgcccctcggacccggccgtgcgctt
cccaagggccccgcccgaggcgcggtgaaggtggggagttttaagcgggagatgaccttc
acgtttcaatcagaggacttcagacgtgactccagtaagaagccgtctcatcacctgttc
ccactggccatggaggaagacgtgagaacagcagacaccaaaaaaaccagtcgggtcctt
gaccaagaaaaagaaactcggtctgtttgtcttcttgagcagaagcggaaagtagtttct
tccaatatcgatgtccctcctgcaagaaaatcttcagaggaactggacatggacaaggtg
actgcagccatggtattgaccagcttgtcaaccagccctttggtccgaagccctcctgtg
cggcctaatgagggtctcagcgggtcctggaaggaaggtgcaccatccagcagcagcagc
agtggctactggagctggagcgctccgagtgaccagtccaacccatccacaccctctcca
ccactgtcagctgacagcttcaagcccttccgcagccccgccccacctgacgatggcatt
gacgaggcagacgccagcaacctgctcttcgatgagcccattccgaggaagagaaagaac
tccatgaaggtgatgttcaaatgcctttggaaaagctgtggcaaggtgctgaacacagct
gccggcatccagaagcacatccgggctgtccacctcgggcgagttggggagtctgactgc
agtgatggggaagaagacttctactacacggagatcaagctcaacacggatgccacggct
gaaggcctcaacactgtggccccggtttcaccctcccagtctctggcttcagcccctgcg
tttcccatcccagactccagccgaacagaaactccttgtgccaaaacagacactaagctg
gtgacgccactgagccgctcagcccccaccaccctctacctcgtgcacactgaccatgct
taccaggccacacccccggtgacgattcctggatccgctaagttcacccccaatggcagc
agcttcagcatttcctggcagtctcccccagtcactttcactggcgttccggtgtctcct
ccacatcatcccacagcaggctcaggagagcagagacagcacgcccacacagccctgtcc
tccccgcccagagggacagtcaccctaaggaagcccagaggagaaggcaaaaagtgccgc
aaggtttatgggatggaaaacagggacatgtggtgcaccgcctgccgctggaagaaggcc
tgccagcggttcattgactga

DBGET integrated database retrieval system