KEGG   Mus musculus (mouse): 170759
Entry
170759            CDS       T01002                                 

Gene name
Atp13a1, Atp13a, Cgi152, catp
Definition
(RefSeq) ATPase type 13A1
  KO
K14950  manganese-transporting P-type ATPase [EC:7.2.2.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    170759 (Atp13a1)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 170759
NCBI-ProteinID: NP_573487
MGI: 2180801
Ensembl: ENSMUSG00000031862
UniProt: Q9EPE9
Position
8; 8 B3.3
AA seq 1200 aa
MAVVGNAVPCGARPGGARDNGSPQPGSRLRPGLAAGPALIANGDELVAAVWPYRRLALLR
RLTVLPFAGLLYPAWLGAAASGCWGWGSSWTQIPEAALLALATICLAHALTVLSGHWSVH
AHCALTCTPEYDPNKVTFVKVVPTPNNGSTELVALHRDKGEDGLEVLSFEFQKIKYSYDA
LEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNKAEMVVPDFSELFKERAT
APFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKPHMIQV
YRSRKWRPVASDDIVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQMKEP
IEDLSPDRVLDLQADARLHVIFGGTKVVQHIPPQKATSGLKPVDNGCVAFVLRTGFNTSQ
GRLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWVEGTKDPSRNRYKLFLECTL
ILTSVVPPELPIELSLAVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTSDSL
VVRGVAGLRDGKEVTPVSSIPIETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTLT
KDEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETLHSM
FSQCPPDYHHIHTEISREGARVLALGYKELGHLTHQQAREIKREALECSLKFVGFIVVSC
PLKADSKAVIREIQNASHRVVMITGDNPLTACHVAQELHFIDKAHTLILHPPSEKGQPCE
WRSIDSSIVLPLTLGSPKALALEHALCLTGDGLAHLQAVDPQQLLCLIPHVQVFARVAPK
QKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANAPERVVERRRRPRDSPVLS
NSGPRVSRSTKQKSALLSPEEPPASHRDRLSQVLRDLEEESTPIVKLGDASIAAPFTSKL
SSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGLLL
AGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFSVHFLSLVYLYREAQARSPEKQ
EQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLAVSLLA
IIGLLLGSSPDFNSQFGLVDIPVEFKLVIGQVLALDFCLALLADRVLQFFLGTPKLRVPS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atggcggtggtgggcaacgcggttccttgcggagcccggcctggcggggcccgggacaac
gggtctcctcagcctgggtcgcgattgcggccgggcctagctgccgggccagcactcata
gcgaacggcgacgaactggtggccgccgtgtggccgtaccggcggctggcgcttctgcgg
cgcctcaccgtgctgccgtttgccgggctgctgtacccagcctggctgggcgccgccgcc
agcggttgctggggatggggcagcagctggacccagatacccgaggccgcgctgctggcg
ctcgccaccatctgcctcgcgcacgcactcactgtcctgtcggggcattggtctgtgcac
gcgcactgcgcgctcacctgcaccccggagtatgatcccaacaaagtaacctttgtgaag
gtggtgccaacccccaacaatggctccactgagcttgtggccctgcaccgtgacaagggt
gaagatgggctggaggtgctgtcatttgaattccagaagatcaaatattcctatgatgcc
ctggagaaaaagcagttccttccggtggccttcccagtggggaatgccttctcttactat
caaagcaacagaggcttccaggaagactcagagatccgagctgcagagaagaagtttgga
agcaacaaggctgagatggtagtgcccgacttctctgagcttttcaaggagagagccaca
gcccctttcttcgtgtttcaggtattctgcgttgggctctggtgcctggacgagtattgg
tactacagtgtcttcactctgtccatgctggtggctttcgaagcttccctagtgcagcag
cagatgaggaacatgtcagagatccgaaagatgggcaacaagccccatatgatacaggtc
taccgcagccgaaagtggaggcctgtcgccagtgatgacattgttcctggggacatcgtg
tctatcggccgctcaccccaggagaacttggtgccctgtgatgtactgctgctacggggc
cgctgcattgtagacgaggccatgctcactggggaatctgtgccacaaatgaaggagccc
attgaagacctgagcccagaccgtgtcctagacctgcaggccgatgctcggctgcatgtc
atctttgggggcaccaaggtggtacagcacattcccccgcagaaggccacctcgggcctg
aagccggtcgacaatggatgtgtggcctttgtcctgagaactgggttcaacacatcccag
ggcagactactgcgtacaattctctttggggtaaagagggtcactgcaaacaacttggag
acctttatcttcatcctcttcctcctggtcttcgccattgctgcagctgcgtatgtgtgg
gttgaagggaccaaggaccccagccggaaccgttacaagctctttctggagtgcaccctc
atcctcacctctgttgtaccccctgaactgcccattgaactgtctctggctgtcaacacc
tccctcatcgccttggccaagctctacatgtactgcacagagcctttccggatccccttc
gctggcaaggttgaagtgtgttgctttgacaagacgggtaccttgaccagtgacagcctg
gtggtgcgaggcgtggcagggctgagagatgggaaagaggtgaccccagtgtccagcatt
cccatagaaacacaccgggccctggcctcctgccactcgctcatgcagctggatgacggc
accctagtgggtgaccctctggaaaaggccatgctgacagctgtggactggacactgacc
aaagatgagaaagtattcccccgaagtattaaaactcaggggctgaaaattcaccagcgc
tttcattttgccagtgccctaaagcgaatgtctgtgctcgcctcctacgagaagcttggc
tccactgacctctgctacatcgcggctgtgaagggggcccccgaaaccctgcactctatg
ttttctcagtgcccacctgactaccaccacatccacactgagatctctcgggaaggagcc
cgtgtcctggctctgggatacaaggagctaggacatctcacacatcagcaggcccgggag
atcaagcgggaggcactggagtgcagcctcaagtttgtgggcttcatcgtggtctcctgt
cccctcaaagctgactccaaggctgtgatccgagagatccagaatgcatcccacagggtg
gtcatgatcacaggagacaaccccctcactgcatgccatgtagctcaggagctgcacttc
attgacaaagcccacacgctcatcttgcatcctccctcggagaaaggccagccatgtgag
tggcgctccattgatagcagcatcgttctgcctctcaccctgggctcccccaaggcactg
gccctggagcacgcgctatgcctcacaggcgatggcttggctcacctgcaggctgtggac
ccccagcagctgctctgcctcatccctcatgtgcaggtgtttgcccgtgtagcccctaag
cagaaggaatttgtcatcactagcctgaaggagctgggttatgtgacccttatgtgtgga
gatggcaccaacgatgtgggcgcactgaagcacgctgatgtgggtgtagcactcctggcc
aatgcccctgagagggttgtagaacggcggcgacggccaagggacagccctgtcctgagc
aacagtggccccagagtctccaggtccaccaaacagaagtcggcactcctctctcctgag
gagccaccagcttcccacagggaccgcctgagccaggtgctgcgggacctggaggaggag
agcacccccatcgtgaagctgggggatgccagcatcgcagcacccttcacctccaagctg
tcctccatccagtgcatctgccacgtgatcaagcagggccggtgcacattggtgacgacg
ctgcagatgttcaagatcctggccctcaatgccctcatcctggcatacagccaaagtgtc
ctctacctggagggtgtcaagttcagtgacttccaggccacactgcaggggctgctgctg
gccggctgcttcctcttcatctcccgctccaagcctctcaagactctttcccgagagcgg
cccctacccaacatcttcaacctgtacaccatccttacggtgatgctgcaattctctgtc
cacttcctgagcctggtctacctgtaccgtgaggcccaggcacgcagccctgagaagcag
gagcagtttgtagacctgtacaaggagtttgagccgagcctggtcaacagcactgtgtac
atcatggccatggccatgcagatggccaccttcgccatcaactacaagggcccacccttc
atggagagcctgcctgagaacaagcccctggtgtggagtctggcagtgtcactgctggcc
atcattggcttgctccttggttcctcacctgacttcaacagccagtttggccttgtggac
atccctgtagagttcaagctggtcatcggccaggtcctggccctggacttctgcctggca
ctcctggctgaccgtgtcctacagttctttttggggactccgaagctgagagtgccttcc
tga

DBGET integrated database retrieval system