KEGG   Mus musculus (mouse): 170767
Entry
170767            CDS       T01002                                 

Gene name
Rfxap, 5730495K23Rik
Definition
(RefSeq) regulatory factor X-associated protein
  KO
K08063  regulatory factor X-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    170767 (Rfxap)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170767 (Rfxap)
  09163 Immune disease
   05340 Primary immunodeficiency
    170767 (Rfxap)
SSDB
Motif
Pfam: RFXA_RFXANK_bdg
Other DBs
NCBI-GeneID: 170767
NCBI-ProteinID: NP_573494
MGI: 2180854
Ensembl: ENSMUSG00000036615
Vega: OTTMUSG00000043569
UniProt: Q8VCG9
Position
3; 3 C
AA seq 231 aa
MEAQAVPEGSGPSTASPRTAPPVTVLVMRQDEAEADGALRPGLAGSEAAADAEDEAGDDD
ADLLDTSDPAGGGESAASPEELEDEDAEGGGAARRRGSKTCTYEGCRETTSQVAKQRKPW
MCKKHRNKMYKDKYKKKKSDQALGSGGPSAASTGNVKLEESTDNILSIVKQRTGSFGDRP
ARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQHFPGAPV
NT seq 696 nt   +upstreamnt  +downstreamnt
acggaggcgcaggctgtgcccgagggctcggggccgagcaccgccagtccccggacggcc
cctccggtgacggtgctggtgatgcggcaggacgaggccgaggcggacggcgctctgagg
ccgggcctggcggggagtgaggcggcggcagacgccgaggacgaggcgggggacgacgac
gccgacctgctggacacatcggacccggcgggcggcggcgagagtgcggccagcccggag
gagctggaggacgaggacgcggagggtggcggcgcagcgcgcaggcgaggctccaagacc
tgcacgtacgagggctgccgcgagaccaccagccaggtggccaagcagcgcaagccctgg
atgtgcaagaagcaccgcaacaagatgtacaaggacaagtacaagaagaagaagagcgac
caggcactgggctctggcggcccgtccgcggccagcacaggcaacgtcaaactggaggaa
agcacagacaacatactctccattgtcaaacagagaacaggatcctttggtgatcgccct
gcaagacctactcttctagagcaagtgttaaatcagaaaagactgtcattactaagaagt
ccagaagttgtccagtttttacagaagcagcagcagctactaaatcagcaagttttggag
caaagacagcagcatttcccaggagcgccagtgtga

KEGG   Mus musculus (mouse): 19727
Entry
19727             CDS       T01002                                 

Gene name
Rfxank, Tv, Tvl1
Definition
(RefSeq) regulatory factor X-associated ankyrin-containing protein
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    19727 (Rfxank)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19727 (Rfxank)
  09163 Immune disease
   05340 Primary immunodeficiency
    19727 (Rfxank)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank_4 Ank
Other DBs
NCBI-GeneID: 19727
NCBI-ProteinID: NP_035396
MGI: 1333865
Ensembl: ENSMUSG00000036120
Vega: OTTMUSG00000062215
UniProt: Q9Z205 Q53X17 Q543F0
Position
8; 8 B3.3
AA seq 269 aa
MEPTQVAENLVPNQQPPVPDLEDPEDTRDESPENSDTVVLSLFPCTPDAVNPEADASASS
LQGSFLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKDHLRKGACPACTCL
SGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKERESALSLASMGGYTD
IVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAV
ALGYRKVQQVMESHILRLFQSTLGPVDPE
NT seq 810 nt   +upstreamnt  +downstreamnt
atggagcccactcaggttgcagagaaccttgtcccaaaccagcaacctcctgttcctgac
ctagaggatcctgaggacaccagagatgagtccccagagaactcagacactgtcgtcctc
agcctgttcccctgcaccccagacgctgtgaatcctgaagcagatgccagtgcatcctca
ctgcagggaagtttcttgaagcactccacaaccctcacaaaccggcaacgtgggaatgag
gtctcagctctgccagccaccctggactccctttctatccaccagcttgcagcccaaggg
gagctgagccaactgaaggatcatctgcggaagggtgcgtgtcctgcctgcacatgcctg
tctggaaacaacctgatcaacaaaccggatgagcgtggcttcacccccctcatctgggcc
tcagcctttggagaaattgagacagttcgcttcctgctagactggggtgctgacccccac
atcctggccaaggagcgggagagcgcactgtcacttgccagtatgggtggctacacggac
atcgtgaggttgctgcttgaccgtgacgtggacatcaacatctatgactggaatggagga
acaccactgctctacgctgtgcgtgggaaccacgtgaagtgtgtggaggccttactggcc
cggggtgctgacctcaccacagaggctgactctggctacaccccaatggatctcgcagtg
gccctgggataccgcaaagtgcaacaggtgatggagagccacatcctcagattgttccag
agcaccctggggcctgtggaccccgagtga

KEGG   Mus musculus (mouse): 53970
Entry
53970             CDS       T01002                                 

Gene name
Rfx5
Definition
(RefSeq) regulatory factor X, 5 (influences HLA class II expression)
  KO
K08061  regulatory factor X 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    53970 (Rfx5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    53970 (Rfx5)
  09163 Immune disease
   05340 Primary immunodeficiency
    53970 (Rfx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    53970 (Rfx5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   RF-X
    53970 (Rfx5)
SSDB
Motif
Pfam: RFX5_DNA_bdg RFX5_N RFX_DNA_binding Pox_D5
Other DBs
NCBI-GeneID: 53970
NCBI-ProteinID: NP_059091
MGI: 1858421
Ensembl: ENSMUSG00000005774
Vega: OTTMUSG00000019670
UniProt: Q9JL61
Position
3 F2.1; 3 40.74 cM
AA seq 658 aa
MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTISKAVQNKVEGILQEVQKFSDNDK
LYLYLQLPSGPSVGEKSSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYC
ESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLK
GSESPEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSA
HAHVLKAGGLAEEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQPPKEQEARAGTDLP
GRAERKKSVIDSSVPAASKPQVNALVARLPVLLPRAPRSLITPISGTLKVATLPLPTRVG
GPQTAVPIINMILPPVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGL
GAGPGPGLGAGLGAGLGLGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPL
SEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPR
LLWETWGSKRENNFIGRPEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDK
IPPVTSKVSVIKGRIQKEALQLVKGEADAATQGNKGLKGRVLQSSLTPEHKDPKATPP
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggcagaagataaacctgatgctaagagccccaagactggggcaaggccccaaggtggt
gctgacgctggagaacctaccaccctcctccaaaggctccgaggtaccatttccaaggcc
gtgcagaacaaagtagagggaattctgcaagaagtacagaaattctcggacaacgacaag
ctgtacctctaccttcagctcccatcggggcccagcgttggcgagaagagctcagagcca
agtctgctcagcaatgaggagtatatgtatgcctataggtggatccgcaaccacctggaa
gagcacatggatacctgcctgccaaagcagagcgtctatgatgcctatcgaaagtactgc
gagagcctcgcctgttgccgcccgctcagcacagccaacttcggtaaaatcatcagagag
atcttccctgacatcaaggcccgaagactcggtggccggggccagtccaaatattgctac
agtggcattcgaaggaagaccttggtatccatgccaccattgcctggactcgacttgaag
ggatctgaaagtccagaaatgggcccagaagtaagcccagcacctcgggatgaactggta
gaagcagcctgtgccctgacttgtgactgggcagagcggatcctgaagcggtccttcagt
tccatcgtccaggtcgcccgctacctcctgcagcagcatctcatctctgcccggtcggca
catgctcatgtgcttaaggccggggggcttgctgaagaggatgaaagagcccctcgagaa
cggtcattatgtaagtccaagaatgtcgtagaaagcctggaagggggaggccctaagaaa
ccagagagaccggcccagcctcctaaagagcaagaagcccgagctgggacagaccttcca
gggcgtgcagaacggaagaagagtgtaattgacagctcggttccagcagccagtaagcca
caagttaatgctcttgtggcccgactgcctgtgctgcttccaagagcaccacgatcactt
atcacacccatttcaggcactctgaaagtagctacgctgcctctacccactagggttgga
gggccccagacagctgtgcccatcatcaacatgatcttaccacctgttcctactttgtca
ggggctgggcctgggcctgggcctggccttgggcctaggtttgggccagggcctgggctt
gggcctgggccggggcctggtctgggggctggtctggggcctgggttagggcctgggctt
ggagctggaccagggcccgggcttggagctgggcttggggctggcctagggcttgggcct
gggcgagttccacctagagcacccattctgcctcgaggtgcagagaacagggaggtaggc
ataagtagtgatccaagacctcatgacaagggtatcaaaaggacagctgaagtgcctctg
agtgaggccagtgggcaggacccaccagttaaagaaatgaagcacgaaacacaggatact
acagtaagtgaagcaaaaaggaagcgaggacgccctcgaaagaagccaggagggagtggg
gaaagaaacgctactcctgagaagtctgcagctattgtgaactctccccgatccccaagg
ctactctgggagacatggggctcaaaaagagaaaacaacttcattgggagaccagaagga
ccagggccagggggtgaggctgagcgggaaacagtgcttgtgcaaggtcagcaagatggt
gctgtttccaaaggagaaaggagcttgagttcccaggaagccaaagaagcagaagataaa
attcctcctgtcacttcaaaagtgagtgttatcaagggcagaattcaaaaagaggctctt
cagttggtaaagggagaggctgatgctgcaacacagggcaacaaagggttaaagggtcgt
gtacttcaaagttccctaacccctgagcataaagaccccaaagcaacacccccatga

DBGET integrated database retrieval system