KEGG   Mus musculus (mouse): 170768
Entry
170768            CDS       T01002                                 

Symbol
Pfkfb3, E330010H22Rik, iPFK-2, uPFK-, uPFK-2
Name
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
  KO
K01103  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 3 [EC:2.7.1.105 3.1.3.46]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00051  Fructose and mannose metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    170768 (Pfkfb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    170768 (Pfkfb3)
   04152 AMPK signaling pathway
    170768 (Pfkfb3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     170768 (Pfkfb3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     170768 (Pfkfb3)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 Zeta_toxin SRP54 AAA_18 DIL APS_kinase
Other DBs
NCBI-GeneID: 170768
NCBI-ProteinID: NP_001171223
MGI: 2181202
Ensembl: ENSMUSG00000026773
Vega: OTTMUSG00000011314
UniProt: A7UAK4 Q7TS91
Position
2; 2 A1
AA seq 462 aa
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMRVRKQCALAALRDVKSYLTKEGGQ
IAVFDATNTTRERRHMILNFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRINCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEYNLQGKIGGDSGLSSRGKKFANALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVSTHRERSENMKSSRSGADSSQKH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgccgttggaactgacccagagccgggtacagaagatctgggtgcccgtcgatcaccga
ccctcgttgcccagatcctgtgggccgaagctgaccaactccccaaccgtgattgtgatg
gtggggctcccagcccggggtaagacttacatctccaagaagctgactcgctacctcaac
tggataggtgttccaacgaaagtgttcaatgtgggagagtatcggcgtgaggctgtgaag
cagtacagctcttacaacttcttccgccctgacaatgaggaagccatgagagtccgaaaa
cagtgtgccttagctgccctgagagatgtcaaaagctacctgacaaaggaaggtggacag
attgcagtttttgatgccaccaatacaactagagaaagaaggcacatgatccttaatttt
gccaaagaaaatgacttcaaggcatttttcatcgagtcggtctgtgacgaccctactgtt
gtggcctccaacatcatggaagttaaaatctccagcccggattacaaagactgcaactca
gcagaagccatggacgacttcatgaagagaatcaattgctatgaagccagctaccagcct
cttgaccctgataaatgtgacagggacttgtcactcatcaaagtgattgatgttggccgg
aggttcttggtgaacagagtgcaggaccacatccagagccgaattgtatactacctgatg
aacatccacgtgcagccccgtaccatctacctgtgtcggcatggcgagaatgagtacaac
ttgcagggcaagattgggggcgactcaggcttgtccagcagaggcaagaagttcgccaat
gccctgagcaagttcgtagaagaacagaatctgaaggacctccgtgtgtggaccagccag
ctgaaaagtaccattcagaccgcggaggccctgaggctcccctacgagcagtggaaggca
ctcaacgagatcgatgctggtgtgtgtgaggaactaacctatgaggagatcagagatacc
taccctgaggagtacgcactgcgtgaacaggacaagtactactatcgctatcccacggga
gagtcctaccaggatcttgtccaacgcctggagcctgtgatcatggaattagagcgccaa
gagaatgtattggtcatctgtcaccaggctgttctacgctgcctactagcctacttcctc
gacaagagtgcagaggagatgccatacctgaaatgtccgctccacactgtcctgaaactg
acacctgtggcatatgggtgccgggtggagtccatttacttgaatgtagaatcggtgagc
acacaccgggagaggtcagagaacatgaagagctcccggagcggtgccgactcttcccag
aagcactaa

DBGET integrated database retrieval system