KEGG   Mus musculus (mouse): 170776
Entry
170776            CDS       T01002                                 

Gene name
Cd209c, SI, SIGNR2, mSI, mSIGNR2
Definition
(RefSeq) CD209c antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170776 (Cd209c)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    170776 (Cd209c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    170776 (Cd209c)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170776 (Cd209c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    170776 (Cd209c)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170776 (Cd209c)
   04090 CD molecules [BR:mmu04090]
    170776 (Cd209c)
   04091 Lectins [BR:mmu04091]
    170776 (Cd209c)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    170776 (Cd209c)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   170776 (Cd209c)
CD molecules [BR:mmu04090]
 Proteins
  170776 (Cd209c)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    170776 (Cd209c)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 170776
NCBI-ProteinID: NP_570973
MGI: 2157945
Ensembl: ENSMUSG00000040165
Vega: OTTMUSG00000027103
UniProt: Q91ZW9
Position
8; 8 A1.1
AA seq 178 aa
MRMHTRLQFLKRVSNVAYSHGQEQAKKEKVYKEMTQLKSQINRLCRPCPWDWTVFQGNCY
FFSKFQQNWNDSVNACRKLDAQLVVIKSDDEQSFLQQTSKEKGYAWMGLSDLKHEGRWHW
VDGSHLLFSFMKYWNKGEPNNEWEEDCAEFRGDGWNDAPCTIKKYWICKKSAMSCTEK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcgcatgcacacccgcctacagtttttaaaaagagtctctaatgttgcctactcccac
ggacaagaacaggcaaagaaggagaaagtatacaaggagatgacccagctgaagtctcaa
ataaaccgcctgtgccgcccttgcccctgggactggacagtcttccaaggaaactgttac
ttcttctccaagttccaacagaactggaatgactctgtcaatgcctgcagaaaattggat
gcccaactagtggttatcaaaagtgatgatgaacagagcttcctgcagcagacttctaaa
gagaaaggctatgcctggatgggcctgtcagacctgaagcatgaaggcagatggcactgg
gtggatggctcacatctgctgttcagtttcatgaaatattggaacaagggagagcccaac
aatgaatgggaagaagactgtgctgaattcagaggcgatggctggaacgatgccccatgt
acaattaagaaatactggatctgcaagaagtctgctatgtcctgcactgaaaaatga

KEGG   Mus musculus (mouse): 170779
Entry
170779            CDS       T01002                                 

Gene name
Cd209d, SI, SIG, SIGN-R3, SIGNR3, mSI, mSIGNR3
Definition
(RefSeq) CD209d antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170779 (Cd209d)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    170779 (Cd209d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    170779 (Cd209d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170779 (Cd209d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    170779 (Cd209d)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170779 (Cd209d)
   04090 CD molecules [BR:mmu04090]
    170779 (Cd209d)
   04091 Lectins [BR:mmu04091]
    170779 (Cd209d)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    170779 (Cd209d)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   170779 (Cd209d)
CD molecules [BR:mmu04090]
 Proteins
  170779 (Cd209d)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    170779 (Cd209d)
SSDB
Motif
Pfam: Lectin_C HERV-K_REC FtsX UL45
Other DBs
NCBI-GeneID: 170779
NCBI-ProteinID: NP_570974
MGI: 2157947
Ensembl: ENSMUSG00000031495
Vega: OTTMUSG00000059325
UniProt: Q91ZW8 Q3UW57
Position
8; 8 A1.1
AA seq 237 aa
MSDSMESKTQQVVIPEDEECLMSGTRYSDISSRLQTKFGIKSLAEYTKQSRNPLVLQLLS
FLFLAGLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFF
SKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWHWVD
GSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICKKVSTSSCTTK
NT seq 714 nt   +upstreamnt  +downstreamnt
atgagtgactccatggaatcaaagacacagcaagtggtcattccagaggatgaagagtgt
ttgatgagtggcaccaggtattctgatatcagctcccgattacaaacaaaatttggaatc
aagagtttggcagagtatacgaagcagagccgcaaccccttggtcctgcagctgctttcc
ttcctgttcttggctgggcttctgctgatcattctgatcctagtgtcaaaggtccccagc
tcagaggttcagaacaaaatctaccaggagctcatgcaactgaaggctgaagttcatgat
ggcttgtgccaaccctgcgccagggactggacattcttcaatggaagctgttacttcttc
tccaagtcccaaagaaattggcacaactccaccactgcctgccaggaactgggggcccaa
ctggtcatcatagagactgatgaggagcagactttcctgcagcagacttctaaggctaga
ggaccaacctggatgggtctctcagacatgcataatgaagccacatggcactgggtggat
ggctcacctctgtcacccagctttacacgctattggaatagaggggagcccaacaatgtc
ggtgatgaagattgtgcagagttctctggggatggctggaatgatctcagttgtgataaa
ctacttttctggatctgtaagaaagtttcaacctcatcatgcaccaccaaatga

KEGG   Mus musculus (mouse): 170780
Entry
170780            CDS       T01002                                 

Gene name
Cd209e, SI, SIGNR4, mSI, mSIGNR4
Definition
(RefSeq) CD209e antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170780 (Cd209e)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    170780 (Cd209e)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    170780 (Cd209e)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170780 (Cd209e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    170780 (Cd209e)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170780 (Cd209e)
   04090 CD molecules [BR:mmu04090]
    170780 (Cd209e)
   04091 Lectins [BR:mmu04091]
    170780 (Cd209e)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    170780 (Cd209e)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   170780 (Cd209e)
CD molecules [BR:mmu04090]
 Proteins
  170780 (Cd209e)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    170780 (Cd209e)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 170780
NCBI-ProteinID: NP_570975
MGI: 2157948
Ensembl: ENSMUSG00000040197
Vega: OTTMUSG00000027102
UniProt: Q91ZW7 Q3KNN8
Position
8; 8 A1.1
AA seq 208 aa
MRAPQMGSLGFLDKGHIPLVLQLLFLILFTGLLVAIIIQVSKMPSSEEIQWEHTKQEKMY
KDLSQLKSEVDRLCRLCPWDWTFFNGNCYFFSKSQRDWHDSMTACKEMGAQLVIIKSHEE
QSFLQQTSKKNSYTWMGLSDLNKEGEWYWLDGSPLSDSFEKYWKKGQPNNVGGQDCVEFR
DNGWNDAKCEQRKFWICKKIATTCLSKW
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagggcaccacagatgggctctctgggatttctagacaaaggccacattcccctggtg
ttgcagctgctgttcctcattctcttcactggacttctggtggccatcatcatccaagtt
tccaagatgcccagctcagaagaaattcagtgggaacacacaaagcaagagaaaatgtac
aaggacctgagccaactgaaatctgaagttgatagactctgtcgcctctgcccttgggat
tggacgttcttcaatggaaactgttactttttctccaagtcacaacgggattggcatgac
tccatgactgcctgcaaagaaatgggagcccaactagtcatcatcaaaagtcatgaggag
cagagcttcctgcagcagacttccaagaaaaatagctacacctggatggggctgtcagat
ctgaacaaggaaggagaatggtactggctggatggttcgcctctgtcagacagctttgaa
aagtattggaagaaaggacagcccaacaatgttgggggacaagactgtgtggaattcaga
gataacggctggaatgatgccaaatgtgaacaaaggaaattctggatctgcaaaaaaatt
gcaactacctgtttgagcaagtggtga

KEGG   Mus musculus (mouse): 170786
Entry
170786            CDS       T01002                                 

Gene name
Cd209a, CD209, CDSIGN, CI, CIRE, DC-S, DC-SI, DC-SIGN, DC-SIGN1, Dcs, Dcsign, SI, SIGN-R1, SIGNR5
Definition
(RefSeq) CD209a antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170786 (Cd209a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    170786 (Cd209a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    170786 (Cd209a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170786 (Cd209a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    170786 (Cd209a)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170786 (Cd209a)
   04090 CD molecules [BR:mmu04090]
    170786 (Cd209a)
   04091 Lectins [BR:mmu04091]
    170786 (Cd209a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    170786 (Cd209a)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   170786 (Cd209a)
CD molecules [BR:mmu04090]
 Proteins
  170786 (Cd209a)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    170786 (Cd209a)
SSDB
Motif
Pfam: Lectin_C Chordopox_A13L
Other DBs
NCBI-GeneID: 170786
NCBI-ProteinID: NP_573501
MGI: 2157942
Ensembl: ENSMUSG00000031494
Vega: OTTMUSG00000059324
UniProt: Q91ZX1
Position
8; 8 A1.1
AA seq 238 aa
MSDSKEMGKRQLRPLDEELLTSSHTRHSIKGFGFQTNSGFSSFTGCLVHSQVPLALQVLF
LAVCSVLLVVILVKVYKIPSSQEENNQMNVYQELTQLKAGVDRLCRSCPWDWTHFQGSCY
FFSVAQKSWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYTWMGLIDMSKESTWYW
VDGSPLTLSFMKYWSKGEPNNLGEEDCAEFRDDGWNDTKCTNKKFWICKKLSTSCPSK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtgattctaaggaaatggggaagaggcagcttcgccctctggatgaggaactgctg
acatccagccacaccaggcactccatcaaaggctttggcttccaaacaaattctggattc
agtagcttcacagggtgcctggtccacagtcaagtccccttggcactgcaggtgctcttc
ctagctgtttgttctgtgctgctggttgtcatccttgtcaaagtctacaaaatacccagt
tctcaggaagaaaacaatcagatgaatgtctaccaagaactgacccagttgaaggctggc
gtagatcgactgtgccgctcctgcccctgggactggacgcacttccaaggaagctgttac
ttcttctctgtggcccagaagtcctggaatgattctgccactgcctgccacaatgtgggg
gctcaacttgtggtcatcaagagtgatgaagagcagaactttctacaacaaacttctaag
aagagaggctacacttggatggggctcattgacatgagcaaggagtctacatggtactgg
gtagatggttcacctctgactctcagtttcatgaagtattggagtaaaggagaacctaac
aacctgggagaggaagactgtgcagagttcagagatgacggctggaatgacaccaaatgt
actaacaagaaattctggatctgcaaaaagctttcaacttcctgccctagcaagtga

KEGG   Mus musculus (mouse): 69142
Entry
69142             CDS       T01002                                 

Gene name
Cd209f, 1810029C22Rik, AI647041, SI, SIGNR8
Definition
(RefSeq) CD209f antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    69142 (Cd209f)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    69142 (Cd209f)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    69142 (Cd209f)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    69142 (Cd209f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69142 (Cd209f)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    69142 (Cd209f)
   04090 CD molecules [BR:mmu04090]
    69142 (Cd209f)
   04091 Lectins [BR:mmu04091]
    69142 (Cd209f)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    69142 (Cd209f)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   69142 (Cd209f)
CD molecules [BR:mmu04090]
 Proteins
  69142 (Cd209f)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    69142 (Cd209f)
SSDB
Motif
Pfam: Lectin_C UL45 DASH_Dam1 Lectin_N
Other DBs
NCBI-GeneID: 69142
NCBI-ProteinID: NP_081232
MGI: 1916392
Ensembl: ENSMUSG00000051906
Vega: OTTMUSG00000033964
UniProt: G3UVT9 Q4KL16
Position
8; 8 A1.1
AA seq 255 aa
MAGEPEFHQSKNHEEEVTSGEQGFAEHDPEGLICSSKSLQGHLTQVPWLLLLLISLGLFL
LMLATLVQVSRIRAYSQGQTQDQQGSSSLDKVAVPREQTHSGLEQIQQIQQQLTQFNASL
AGLCRPCPWDWELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQRFMKYWNVR
KNQRSWIGLSDHIHEGSWQWVDGSALKFSFWKEGEPNNDGDEDCVELFMDDWNDNKCTEQ
NFWVCEQPSAPCPHH
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcaggagagccagagttccatcagtcaaagaatcatgaggaggaggtcacatctgga
gagcagggatttgctgagcatgaccccgagggtctcatttgcagctccaagagtttacaa
gggcatctgacccaagtcccctggcttctgctgcttctcatctctttgggcctctttttg
cttatgttggccaccctggttcaagtctccaggattcgtgcatactcacagggacagacc
caggatcagcagggtagctccagcttggacaaggttgccgttcctcgggagcagacacac
tccggcttggagcagatccagcagattcagcagcagctgactcagttcaacgcctcgctg
gctggcctgtgccggccctgtccctgggactgggagctcttccagggaagctgctacctc
ttctccagaaccctgggcagctgggaaacctctgcctcctcctgcgaggatctcggggcc
cacctggtgattgtcaacagtgtttcagagcagagattcatgaaatattggaatgtgagg
aaaaaccaacgctcctggatcggcctcagtgaccatatacatgaaggttcctggcagtgg
gtggacggcagcgccctcaagttcagcttttggaaagagggggaacctaacaatgacgga
gatgaggactgcgtggagctgttcatggatgattggaatgataataagtgcactgaacag
aacttttgggtctgtgagcagccctctgctccctgccctcatcactga

KEGG   Mus musculus (mouse): 69165
Entry
69165             CDS       T01002                                 

Gene name
Cd209b, 1810030I22Rik, DC-SIGNR1, OtB7, SI, SIGNR1, mSI, mSIGNR1
Definition
(RefSeq) CD209b antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    69165 (Cd209b)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    69165 (Cd209b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    69165 (Cd209b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    69165 (Cd209b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69165 (Cd209b)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    69165 (Cd209b)
   04090 CD molecules [BR:mmu04090]
    69165 (Cd209b)
   04091 Lectins [BR:mmu04091]
    69165 (Cd209b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    69165 (Cd209b)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   69165 (Cd209b)
CD molecules [BR:mmu04090]
 Proteins
  69165 (Cd209b)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    69165 (Cd209b)
SSDB
Motif
Pfam: Lectin_C PspB HERV-K_REC
Other DBs
NCBI-GeneID: 69165
NCBI-ProteinID: NP_081248
MGI: 1916415
Ensembl: ENSMUSG00000065987
Vega: OTTMUSG00000049043
UniProt: Q8CJ91 Q8CJ85 Q3UTX5
Structure
PDB: 
3ZHG 4CAJ 4C9F

Position
8; 8 A1.1
AA seq 325 aa
MSDSTEAKMQPLSSMDDDELMVSGSRYSIKSSRLRPNSGIKCLAGCSGHSQVPLVLQLLS
FLFLAGLLLIILFQVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKIT
EQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQ
LVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQT
FLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGD
GWNDSKCELKKFWICKKSATPCTEG
NT seq 978 nt   +upstreamnt  +downstreamnt
atgagtgactccacagaagccaagatgcagcctcttagctccatggacgatgatgagttg
atggtcagcggcagcaggtattctattaaaagctccagactacgaccaaattctggaatc
aagtgtttggcaggatgctcgggacacagccaagtccccttggtcctgcagctgctctcc
ttcctgttcttggctgggctcctgctgatcattcttttccaagtctccaaaaccccaaat
accgagaggcagaaggaacaagagaagatcctccaggaactgacccagctgacagatgag
cttacgtccaggatccccatctcccaagggaagaatgagtccatgcaggcgaagatcact
gagcaactgatgcagctgaaaactgaactcttgtccaggattcccatcttccaggggcag
aatgagtccatacaagagaagatctctgagcaactgatgcagctgaaggctgaacttctt
tccaagatctccagcttcccggtaaaggatgattctaagcaggagaagatctaccaacag
ctggtacagatgaagactgaactcttccgcctgtgtcgactctgcccctgggactggaca
ttcctcctaggaaattgttacttcttctccaagtcccagcggaactggaatgacgccgtc
acagcttgcaaagaagtgaaggctcaactagtcatcatcaatagtgatgaagagcagacc
ttcctgcagcagacttctaaggctaaaggaccaacctggatgggcctgtcagacctgaag
aaggaggccacgtggctctgggtagatggttctactctgtcatccagattccagaaatat
tggaatagaggggagcctaacaacatcggtgaggaagactgtgtcgaatttgctggggat
ggctggaatgactctaaatgtgaactcaaaaagttctggatctgcaagaagtctgcaacc
ccatgcactgaaggctag

KEGG   Mus musculus (mouse): 70192
Entry
70192             CDS       T01002                                 

Gene name
Cd209g, 2310066I10Rik, AI481039, SIGNR7
Definition
(RefSeq) CD209g antigen
  KO
K06563  C-type lectin domain family 4 member M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    70192 (Cd209g)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    70192 (Cd209g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    70192 (Cd209g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    70192 (Cd209g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70192 (Cd209g)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    70192 (Cd209g)
   04090 CD molecules [BR:mmu04090]
    70192 (Cd209g)
   04091 Lectins [BR:mmu04091]
    70192 (Cd209g)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    70192 (Cd209g)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   70192 (Cd209g)
CD molecules [BR:mmu04090]
 Proteins
  70192 (Cd209g)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    70192 (Cd209g)
SSDB
Motif
Pfam: Lectin_C DASH_Dam1 UL45
Other DBs
NCBI-GeneID: 70192
NCBI-ProteinID: NP_081619
MGI: 1917442
Ensembl: ENSMUSG00000079168
Vega: OTTMUSG00000033965
UniProt: D3Z5D4
Position
8; 8 A1.1
AA seq 194 aa
MLATLVQVSRIRAYSQGQTQDQQGSSSLDKVAVPREQTHSGLEQIQQIQQQLTQFNASLA
GLCRPCPWDWELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQQFLKYWHIRK
NQLTWIGLSDHRSEGSWQWVDDTPLKLSFWKEGEPNNEGDEDCVVMAEDKWNDSRCTANN
FWVCEQPSAPCPGY
NT seq 585 nt   +upstreamnt  +downstreamnt
atgttggccaccctggttcaagtctccaggattcgtgcatactcacagggacagacccag
gatcagcagggtagctccagcttggacaaggttgccgttcctcgggagcagacacactcc
ggcttggagcagatccagcagattcagcagcagctgactcagttcaacgcctcgctggct
ggcctgtgccggccctgtccctgggactgggagctcttccagggaagctgctacctcttc
tccagaaccctgggcagctgggaaacctctgcctcctcctgcgaggatctcggggcccac
ctggtgattgtcaacagtgtttcagagcagcaattcctcaaatactggcacatcagaaag
aatcagctcacctggatcggcctcagcgatcacagaagtgaaggttcctggcagtgggta
gatgacaccccactcaaactcagcttctggaaagaaggggagcccaataatgaaggggac
gaggactgcgtggtaatggcagaagataaatggaatgacagccgttgtactgcaaacaac
ttctgggtctgtgagcagccctcggctccctgccctggttactga

DBGET integrated database retrieval system