KEGG   Mus musculus (mouse): 170789
Entry
170789            CDS       T01002                                 

Gene name
Acot8, PTE-, PTE-1, PTE-2, Pte, Pte1
Definition
(RefSeq) acyl-CoA thioesterase 8
  KO
K11992  acyl-CoA thioesterase 8 [EC:3.1.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    170789 (Acot8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    170789 (Acot8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.27  choloyl-CoA hydrolase
     170789 (Acot8)
SSDB
Motif
Pfam: 4HBT_3 Acyl_CoA_thio
Other DBs
NCBI-GeneID: 170789
NCBI-ProteinID: NP_573503
MGI: 2158201
Ensembl: ENSMUSG00000017307
Vega: OTTMUSG00000001161
UniProt: P58137 Q3U965
Position
2; 2 H3
AA seq 320 aa
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQI
MGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGK
AIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVA
AQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTA
LLPHQSKYKVNFMASLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLA
VTCAQEGVIRLKPQVSESKL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtcagcgccagagggtctgggagatgctcatggcgacgccgaccgcggcgacctttcc
ggggacctccgtagtgtgctggtcacgagcgtgctcaacctcgagccgctagatgaagat
ctctacagaggaaggcattactgggtacctacctcccagcggctctttgggggtcaaatt
atgggccaggccctggtggctgcagccaagtctgtgagtgaagacgtccatgtccactcc
ctgcactgctactttgtccgggcaggggacccgaaagtgccagtgctgtaccacgtagag
aggatacggacaggagccagcttctcagtgcgcgccgtgaaggctgtgcagcatggcaag
gccatcttcatctgccaggcctccttccagcagatgcagcccagcccgctgcagcaccag
ttctccatgccctccgtgcccccgccagaagacctgctggatcacgaggccctcattgac
cagtacttaagggaccctaaccttcacaagaagtatcgagtggggctgaaccgagttgct
gcccaggaggtacctattgagatcaaggtggtgaacccacccaccctgacccagctgcag
gcactggagcccaaacagatgttctgggtgcgtgcccggggctacattggggaaggtgac
atcaagatgcattgctgtgtggctgcttatatctctgactacgccttcctgggtacagca
ctgctgccccaccagtccaagtataaggtgaacttcatggcgtcactggatcactccatg
tggtttcatgccccattccgagccgaccactggatgctgtacgagtgtgagagcccctgg
gctggtggctctcgagggctggtgcatgggcggctgtggcgtcgggatggggtccttgct
gtgacctgtgcccaggagggtgtgatccgattgaagcctcaggtgtcagagagtaagcta
tag

DBGET integrated database retrieval system