KEGG   Mus musculus (house mouse): 170790
Entry
170790            CDS       T01002                                 
Symbol
Mlc1, Kiaa0027-hp, LVM, MLC, VL, WKL1
Name
(RefSeq) megalencephalic leukoencephalopathy with subcortical cysts 1 homolog (human)
  KO
K20070  membrane protein MLC1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    170790 (Mlc1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    170790 (Mlc1)
SSDB
Motif
Pfam: DoxX_2
Other DBs
NCBI-GeneID: 170790
NCBI-ProteinID: NP_573504
MGI: 2157910
Ensembl: ENSMUSG00000035805
UniProt: Q8VHK5
Position
15:complement(88840087..88863192)
AA seq 382 aa
MTREGQFREELGYDRMPTLERGRQDAGRQDPGSYTPDSKPKDLQLSKRLPPCFSYKTWVF
SVLMGSCLLVTSGFSLYLGNVFPSEMDYLRCAAGSCIPSAIVSFAVGRRNVSAIPNFQIL
FVSTFAVTTTCLIWFGCKLILNPSAININFNLILLLLLELLMAATVIISARSSEEPCKKK
KGSISDGSNILDEVTFPARVLKSYSVVEVIAGVSAVLGGVIALNVEEAVSGPHLSVTFFW
ILVACFPSAIASHVTAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSVMRVVEIFKDYP
PAIKSYDVLLLLLLLLLLLQGGLNTGTAIQCVSFKVSARLQAASWDPQSCPQERPAGEVV
RGPLKEFDKEKAWRAVVVQMAQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgacacgggaggggcagttcagggaggaactgggctatgaccggatgcccacactggag
aggggtcggcaggatgcaggacggcaggacccaggcagctacacccctgactcaaagccc
aaggacctgcagctgtcgaagaggttgcccccgtgcttcagctacaagacatgggtgttc
tctgtgttaatggggagctgccttcttgtgacctctgggttttcgctctacttggggaac
gtgttcccctccgagatggattatttgcgctgtgcagcaggctcttgcatcccctcagca
attgtgagcttcgctgtagggaggagaaatgtcagtgcgattcccaactttcagatattg
tttgtttccacgttcgctgtgactactacgtgtttgatctggtttgggtgtaaactgatc
ctgaatccttcagccataaacattaatttcaacctcatcctgctcctgctgttggagctc
ctcatggcagccacggtgatcatttcggcccggtccagtgaggagccctgcaagaagaag
aagggttccatctccgatggctctaacattctggatgaagtgacgtttcctgctcgggtc
ctaaagtcctactctgtggtagaagtaattgctggtgtctccgctgtcctcggtggggtg
atcgctctaaacgtagaggaagctgtctcgggtccacatctctcggtgacgttcttttgg
attttagtggcttgttttcccagtgccattgccagccatgtgacagcggaatgtcccagc
aagtgtctggttgaggtgctgatagccatcagcagcctcacatccccactgctattcact
gcctctggatatctgtccttcagtgtgatgagagtcgtggagatttttaaagattacccg
ccagccatcaaatcttatgatgttctcctgctgctcctgttgctgctgctgctgcttcag
gggggactcaacactggcaccgccatccagtgtgtgagcttcaaagtcagcgcccggctg
caggctgcatcctgggacccccagtcctgtccccaggagcggccagcaggggaggtggtc
cgaggccccctcaaggagtttgacaaagagaaagcctggagagctgtggtggtacaaatg
gcccagtga

DBGET integrated database retrieval system