KEGG   Mus musculus (mouse): 17082Help
Entry
17082             CDS       T01002                                 

Gene name
Il1rl1, DER4, Fit-1, Ly84, ST2L, St2, St2-rs1, T1, T1/ST2
Definition
(RefSeq) interleukin 1 receptor-like 1
  KO
K05171  interleukin 1 receptor-like 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17082 (Il1rl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    17082 (Il1rl1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL1 receptor family
   17082 (Il1rl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 I-set ig Ig_2 Ig_6 TIR_2 V-set Ig_5 Ig_4
Motif
Other DBs
NCBI-GeneID: 17082
NCBI-ProteinID: NP_001020773
MGI: 98427
Ensembl: ENSMUSG00000026069
Vega: OTTMUSG00000037806
UniProt: P14719
Structure
PDB: 

Position
1 B; 1 19.19 cM
AA seq 567 aa AA seqDB search
MIDRQRMGLWALAILTLPMYLTVTEGSKSSWGLENEALIVRCPQRGRSTYPVEWYYSDTN
ESIPTQKRNRIFVSRDRLKFLPARVEDSGIYACVIRSPNLNKTGYLNVTIHKKPPSCNIP
DYLMYSTVRGSDKNFKITCPTIDLYNWTAPVQWFKNCKALQEPRFRAHRSYLFIDNVTHD
DEGDYTCQFTHAENGTNYIVTATRSFTVEEKGFSMFPVITNPPYNHTMEVEIGKPASIAC
SACFGKGSHFLADVLWQINKTVVGNFGEARIQEEEGRNESSSNDMDCLTSVLRITGVTEK
DLSLEYDCLALNLHGMIRHTIRLRRKQPIDHRSIYYIVAGCSLLLMFINVLVIVLKVFWI
EVALFWRDIVTPYKTRNDGKLYDAYIIYPRVFRGSAAGTHSVEYFVHHTLPDVLENKCGY
KLCIYGRDLLPGQDAATVVESSIQNSRRQVFVLAPHMMHSKEFAYEQEIALHSALIQNNS
KVILIEMEPLGEASRLQVGDLQDSLQHLVKIQGTIKWREDHVADKQSLSSKFWKHVRYQM
PVPERASKTASVAAPLSGKACLDLKHF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgattgacagacagagaatgggactttgggctttggcaattctgacacttcccatgtat
ttgacagttacggagggcagtaaatcgtcctggggtctggaaaatgaggctttaattgtg
agatgcccccaaagaggacgctcgacttatcctgtggaatggtattactcagatacaaat
gaaagtattcctactcaaaaaagaaatcggatctttgtctcaagagatcgtctgaagttt
ctaccagccagagtggaagactctgggatttatgcttgtgttatcagaagccccaacttg
aataagactggatacttgaatgtcaccatacataaaaagccgccaagctgcaatatccct
gattatttgatgtactcgacagtacgtggatcagataaaaatttcaagataacgtgtcca
acaattgacctgtataattggacagcacctgttcagtggtttaagaactgcaaagctctc
caagagccaaggttcagggcacacaggtcctacttgttcattgacaacgtgactcatgat
gatgaaggtgactacacttgtcaattcacacacgcggagaatggaaccaactacatcgtg
acggccaccagatcattcacagttgaagaaaaaggcttttctatgtttccagtaattaca
aatcctccatacaaccacacaatggaagtggaaataggaaaaccagcaagtattgcctgt
tcagcttgctttggcaaaggctctcacttcttggctgatgtcctgtggcagattaacaaa
acagtagttggaaattttggtgaagcaagaattcaagaagaggaaggtcgaaatgaaagt
tccagcaatgacatggattgtttaacctcagtgttaaggataactggtgtgacagaaaag
gacctgtccctggaatatgactgtctggccctgaaccttcatggcatgataaggcacacc
ataaggctgagaaggaaacaaccaattgatcaccgaagcatctactacatagttgctgga
tgtagtttattgctaatgtttatcaatgtcttggtgatagtcttaaaagtgttctggatt
gaggttgctctgttctggagagatatagtgacaccttacaaaacccggaacgatggcaag
ctctacgatgcgtacatcatttaccctcgggtcttccggggcagcgcggcgggaacccac
tctgtggagtactttgttcaccacactctgcccgacgttcttgaaaataaatgtggctac
aaattgtgcatttatgggagagacctgttacctgggcaagatgcagccaccgtggtggaa
agcagtatccagaatagcagaagacaggtgtttgttctggcccctcacatgatgcacagc
aaggaatttgcctacgagcaggagattgctctgcacagcgccctcatccagaacaactcc
aaggtgattcttattgaaatggagcctctgggtgaggcaagccgactacaggttggggac
ctgcaagattctctccagcatcttgtgaaaattcaggggaccatcaagtggagggaagat
catgtggccgacaagcagtctctaagttccaaattctggaagcatgtgaggtaccaaatg
ccagtgccagaaagagcctccaagacggcatctgttgcggctccgttgagtggcaaggca
tgcttagacctgaaacacttttga

DBGET integrated database retrieval system