KEGG   Mus musculus (mouse): 170823
Entry
170823            CDS       T01002                                 

Symbol
Glmn, 9330160J16Rik, AW227515, Fap48, Fap68
Name
(RefSeq) glomulin, FKBP associated protein
  KO
K23345  glomulin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    170823 (Glmn)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    170823 (Glmn)
SSDB
Motif
Pfam: Kinetochor_Ybp2
Other DBs
NCBI-GeneID: 170823
NCBI-ProteinID: NP_001155210
MGI: 2141180
Ensembl: ENSMUSG00000029276
Vega: OTTMUSG00000023402
UniProt: Q8BZM1
Position
5; 5 F
AA seq 596 aa
MAVEELQSIIKRCQILEEHDFKEEDFGLFQLAGQRCIEDGYINQLLEIIQDEKNKTIIKS
MGWNLVGPVVRCLLRGREEDKREECFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQI
ILLLLQPLQTVIQKLPNNKAYSVGLALSTLWSQLSLLPVPHSEEQIQADDYGLCQCCKAL
IEFTKPFVEEVISDKENKENAKLKDELLKFCFKGLKCPLLTAQFLEQSEDVGNDPFRCFA
SEIIGFLSKIGHPVPQIILNHGRKKRTWDYLEFEEEEDKQLAESVASLTYLVFVQGIGID
QLPMVLSPSYLLQLNMEHIEVFLQRTEQSIYSKGLELLETSLLRLEDNSLCYQYLEIKSF
LAVPQGLVKVMTLCPIETLRKKGLSMLQLFIDKLDSQGKYTLFRCLLNTSNHSGVEAFVI
QNIKNQIDLSFKKTYNKWFAGAQLISLLDLVLSLPEGAETDLLQNSDRIMASLNLLRYLV
IKDNEDDNQTGLWTELGKIENNFLKPLHIGLNMSKAHYEAEIKNSQQNNQVASMCKGVCS
VTVGGEEIPSMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKSKSTSEENVGIK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggctgtggaggaacttcagagcataataaaaagatgtcaaatcctagaagagcatgat
tttaaagaagaagattttggcctctttcagttagcaggtcaaagatgcattgaagatggt
tatataaaccagctgctagagattattcaagatgaaaagaacaagaccatcattaagtct
atggggtggaatcttgttggtccagttgttcgatgcctcctgaggggcagagaagaggat
aaaagagaagagtgttttctgatatttgatttgctggtgaagttatgtaatccaaaggaa
ttgttgttgggtttgcttgaactcattgaagagccctccggaaaacagatttcccaaatt
attcttcttttactgcaaccattacaaacagttattcagaaacttcctaacaacaaggca
tactccgttggactagcattgtcaacactttggagtcagctgtctcttcttcctgttcca
cactcagaagaacaaattcaggcagatgattatggcctctgtcagtgttgtaaggccttg
atagagttcacgaaaccttttgtggaagaagtaataagtgataaagaaaacaaagaaaat
gcaaaactaaaagatgaattactgaaattttgtttcaaaggcttgaaatgccctttgctg
acagcacaattcctcgaacagtcagaagacgttggaaatgacccttttcggtgttttgca
tctgaaataataggatttttatcaaaaattggacaccctgtcccccaaattattcttaat
catggaaggaaaaaaaggacttgggattaccttgaatttgaagaagaagaagacaaacaa
ctggcagagtctgtggcttctctgacatatctagtatttgttcagggcatcggtattgat
cagctgcccatggtcttaagcccatcgtaccttctgcagttgaacatggagcatattgaa
gtgtttctgcaaagaacagaacagtctatttactccaaaggattggaacttctggagact
agcttattgagattagaagacaacagcctatgttatcagtacttagaaatcaagagtttt
cttgctgtgcctcagggcttagtcaaagttatgacactttgccccattgagacattgagg
aaaaaaggtttatctatgcttcagctgtttattgacaagttggattcacaaggcaaatat
acattatttaggtgcttactaaatacaagtaatcactcaggagtggaagcctttgtaatt
caaaacatcaaaaatcagattgatttatcatttaagaaaacatataacaaatggtttgca
ggagcacagctgatctctctgttagacctggtcctgtctctccctgagggcgctgagaca
gacttactgcagaactcagacaggattatggcttcattaaatttattgaggtatttggtt
atcaaagataatgaagatgacaatcaaactggattatggacagaacttggaaaaattgaa
aataactttctaaagccacttcatataggacttaatatgtcaaaagcacattatgaagca
gaaattaaaaacagccaacaaaataaccaagtagcctcaatgtgtaaaggtgtttgttcc
gtgactgtaggtggagaagaaatcccttctatgcctcctgaaatgcagcttaaggtctta
cattccgctctcttcacatttgacttgattgaaagtgttctggctcgagtagaagaactc
attgaaatcaaatcaaagtctacctctgaagaaaatgttgggataaagtaa

DBGET integrated database retrieval system