KEGG   Mus musculus (mouse): 170826
Entry
170826            CDS       T01002                                 

Gene name
Ppargc1b, 4631412G21Rik, PGC-1beta, PGC-1beta/ERRL1, PPARGC-1-beta, Perc
Definition
(RefSeq) peroxisome proliferative activated receptor, gamma, coactivator 1 beta
  KO
K17962  peroxisome proliferator-activated receptor gamma coactivator 1-beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    170826 (Ppargc1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    170826 (Ppargc1b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    170826 (Ppargc1b)
SSDB
Motif
Pfam: RRM_1 DUF2052 PBP1_TM
Other DBs
NCBI-GeneID: 170826
NCBI-ProteinID: NP_573512
MGI: 2444934
Ensembl: ENSMUSG00000033871
Vega: OTTMUSG00000024012
UniProt: Q8VHJ7
Position
18; 18 E1
AA seq 1014 aa
MAGNDCGALLDEELSSFFLNYLSDTQGGDSGEEQLCADLPELDLSQLDASDFDSATCFGE
LQWCPETSETEPSQYSPDDSELFQIDSENEALLAALTKTLDDIPEDDVGLAAFPELDEGD
TPSCTPASPAPLSAPPSPTLERLLSPASDVDELSLLQKLLLATSSPTASSDALKDGATWS
QTSLSSRSQRPCVKVDGTQDKKTPTLRAQSRPCTELHKHLTSVLPCPRVKACSPTPHPSP
RLLSKEEEEEVGEDCPSPWPTPASPQDSLAQDTASPDSAQPPEEDVRAMVQLIRYMHTYC
LPQRKLPQRAPEPIPQACSSLSRQVQPRSRHPPKAFWTEFSILRELLAQDILCDVSKPYR
LAIPVYASLTPQSRPRPPKDSQASPAHSAMAEEVRITASPKSTGPRPSLRPLRLEVKRDV
NKPTRQKREEDEEEEEEEEEEEEEKEEEEEEWGRKRPGRGLPWTKLGRKMDSSVCPVRRS
RRLNPELGPWLTFTDEPLGALPSMCLDTETHNLEEDLGSLTDSSQGRQLPQGSQIPALES
PCESGCGDTDEDPSCPQPTSRDSSRCLMLALSQSDSLGKKSFEESLTVELCGTAGLTPPT
TPPYKPMEEDPFKPDTKLSPGQDTAPSLPSPEALPLTATPGASHKLPKRHPERSELLSHL
QHATTQPVSQAGQKRPFSCSFGDHDYCQVLRPEAALQRKVLRSWEPIGVHLEDLAQQGAP
LPTETKAPRREANQNCDPTHKDSMQLRDHEIRASLTKHFGLLETALEGEDLASCKSPEYD
TVFEDSSSSSGESSFLLEEEEEEEEGGEEDDEGEDSGVSPPCSDHCPYQSPPSKASRQLC
SRSRSSSGSSSCSSWSPATRKNFRRESRGPCSDGTPSVRHARKRREKAIGEGRVVYIRNL
SSDMSSRELKKRFEVFGEIVECQVLTRSKRGQKHGFITFRCSEHAALSVRNGATLRKRNE
PSFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLLKEAQQSLH
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggggaacgactgcggcgcgctgctggatgaagagctctcgtccttcttcctcaac
tatctctctgacacgcagggtggggactctggagaggaacagctgtgtgctgacttgcca
gagcttgacctctcccagctggacgccagtgactttgactcagccacgtgctttggggag
ctgcagtggtgcccggagacctcagagacagagcccagccagtacagccccgatgactcc
gagctcttccagattgacagtgagaatgaagctctcttggctgcgcttacgaagaccctg
gatgacatccccgaagacgatgtggggctggctgccttcccagaactggatgaaggcgac
acaccatcctgcaccccagcctcacctgcccccttatctgcaccccccagccccaccctg
gagaggcttctgtccccagcgtctgacgtggacgagctttcactgctacagaagctcctc
ctggccacatcctccccaacagcaagctctgacgctctgaaggacggggccacctggtcc
cagaccagcctcagttccagaagtcagcggccttgtgtcaaggtggatggcacccaggat
aagaagacccccacactgcgggctcagagccggccttgtacggaactgcataagcacctc
acttcggtgctgccctgtcccagagtgaaagcctgctccccaactccgcacccgagccct
cggctcctctccaaagaggaggaggaggaggtgggggaggattgcccaagcccttggccg
actccagcctcgccccaagactccctagcacaggacacggccagccccgacagtgcccag
cctcccgaggaggatgtgagggccatggtacagctcattcgctacatgcatacctactgc
ctgcctcagaggaagctgccccaacgggccccagagccaatcccccaggcctgcagcagc
ctctccaggcaggttcaaccccgatcccggcatccccccaaagccttctggactgagttc
tctatcctaagggaacttctggcccaagatatcctctgtgatgttagcaagccctaccgc
ctggccatacctgtctatgcttccctcacacctcagtccaggcccaggccccccaaggac
agtcaggcctcccctgcccactctgccatggcagaagaggtgagaatcactgcttccccc
aagagcaccgggcctagacccagcctgcgtcctctgaggctggaggtgaaacgggatgtt
aacaagcctacaaggcaaaagcgggaggaagatgaggaggaggaggaggaagaagaagaa
gaggaagaagaaaaagaagaggaagaagaggagtggggcaggaagagaccaggtcgtggc
ctgccatggaccaaactagggaggaagatggacagctccgtgtgccccgtgcggcgctcc
aggagactgaatccagagctgggtccctggctgacattcactgatgagcccttaggtgct
ctgccctcgatgtgcctggatacagagacccacaacctggaggaagacctgggcagcctc
acagacagtagtcaaggccggcagctcccccagggatcccagatccccgccctggaaagc
ccctgtgagagtgggtgcggagacacagatgaagatccaagctgcccacagcccacttcc
agagactcctccaggtgcctcatgctggccttgtcacaaagcgactctcttggcaagaag
agctttgaggagtccctgacggtggagctttgcggcacggcaggactcacgccacccacc
acacctccatacaagccaatggaggaggaccccttcaagccagacaccaagctcagccca
ggccaagacacagctcccagccttccctcccccgaggctcttccgctcacagccacccca
ggagcttcccacaagctgcccaagaggcacccagagcgaagcgagctcctgtcccatttg
cagcatgccacaacccaaccagtctcacaggctggccagaagcgccccttctcctgctcc
tttggagaccacgactactgccaggtgctcaggccagaggctgccctgcagaggaaggtg
ctgcggtcctgggagccaatcggggtccaccttgaagacttggcccagcagggtgcccct
ctgccaacggaaacaaaggcccctaggagggaggcaaaccagaactgtgaccctacccac
aaggacagcatgcagctaagagaccatgagatccgtgccagtctcacaaagcactttggg
ctgctggagactgctctggaaggtgaagacctggcgtcctgtaaaagcccggagtatgac
accgtatttgaggacagcagcagcagcagtggcgagagtagcttcctgcttgaggaggag
gaggaagaggaggagggaggggaagaggacgatgaaggagaggactcaggggtcagccct
ccctgctctgatcactgcccctaccagagcccacccagtaaggccagtcggcagctctgc
tcccgaagccgctccagttccggctcctcgtcctgcagctcctggtcaccagccacccgg
aagaacttcagacgtgagagcagagggccctgttcagatggaaccccaagcgtccggcat
gccaggaagcggcgggaaaaggccatcggtgaaggccgtgtggtatacattcgaaatctc
tccagtgacatgagctctcgggaactaaagaagcgctttgaggtgttcggtgagattgta
gagtgccaggtgctgacgagaagtaaaagaggccagaagcacggttttatcaccttccgg
tgttcagagcacgctgccctgtccgtgaggaacggcgccaccctgagaaagcgcaatgag
ccctccttccacctgagctatggagggctccggcacttccgttggcccagatacactgac
tatgatcccacatctgaggagtcccttccctcatctgggaaaagcaagtacgaagccatg
gattttgacagcttactgaaagaggcccagcagagcctgcattga

DBGET integrated database retrieval system