KEGG   Mus musculus (mouse): 17083Help
Entry
17083             CDS       T01002                                 

Gene name
Tmed1, Il1rl1l, Ly84l, St2l
Definition
(RefSeq) transmembrane p24 trafficking protein 1
  KO
K20348  p24 family protein gamma-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17083 (Tmed1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    17083 (Tmed1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    17083 (Tmed1)
Transporters [BR:mmu02000]
 Other transporters
  Others
   17083 (Tmed1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 17083
NCBI-ProteinID: NP_034874
MGI: 106201
Ensembl: ENSMUSG00000032180
Vega: OTTMUSG00000063454
UniProt: Q3V009 B2RRM5
Position
9; 9 A3
AA seq 227 aa AA seqDB search
MMAAGAAVALALWLLLPAVGVGEAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYRLCFDNSFSTISEKLVF
FELIFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEA
RDRNLQEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDKRPVPT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccggcgcggccgtagcactggccctgtggctactcctgccagcagtagga
gtgggagaggcagggccgccgcctatccaggacggcgagttcacatttctgcttcccgcc
gggagaaagcagtgtttctatcagtccgcaccggccaatgctagtcttgagaccgagtac
caggtgatcggaggtgctgggctggacgtggacttcaccttggagagccctcagggtgtg
ctgttggtcagtgagtctcgaaaggctgatggggtacacacggtggagcctactgaggcc
ggagactacaggctgtgctttgacaactccttcagcaccatctcagaaaagcttgtgttc
tttgagctcatctttgacagcttccaagatgaggaggaggtagaaggttgggcggaggct
gtggagccagaagagatgcttgatgtcaaaatggaagacatcaaggaatccatagagacc
atgaggacccggctggaacggagcatccagatgctcactctgctccgagcctttgaggct
cgtgatcgaaatcttcaagaagacaacctggagcgggtcaacttctggtcagctgccaat
gtggctgtgttgctgctggtggctgtcctgcaagtctgcacactcaagcgcttcttccat
gacaagcgccctgtacccacgtag

DBGET integrated database retrieval system