KEGG   Mus musculus (mouse): 17086
Entry
17086             CDS       T01002                                 

Gene name
Ncr1, Ly9, Ly94, NKp, NKp46
Definition
(RefSeq) natural cytotoxicity triggering receptor 1
  KO
K06741  natural cytotoxicity triggering receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    17086 (Ncr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    17086 (Ncr1)
CD molecules [BR:mmu04090]
 Proteins
  17086 (Ncr1)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 17086
NCBI-ProteinID: NP_034876
MGI: 1336212
Ensembl: ENSMUSG00000062524
Vega: OTTMUSG00000027904
UniProt: Q8C567 A0A0R4IZY7
Position
7; 7 A1
AA seq 325 aa
MLPTLTALLCLGLCLSQRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQL
YFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGL
YDTPNLWVYPQPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPV
TRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNES
GLQKDSAFWDHTTQNLIRIGLACIILITLVWLLTEDWLSKRKDHEEANRLTNWECRRRWR
MQHYFEEEQRNAISMMELKATPGAL
NT seq 978 nt   +upstreamnt  +downstreamnt
atgctgccaacactcactgccctactgtgccttgggctatgtctgagccagaggatcaac
actgaaaaggagactctcccgaaacccatcatctgggccaaacccagcatcatggtcaca
aatggaaactcggtgaacatctggtgtcagggggctcagagtgcttctgagtatcaactg
tactttgaaggaagcttttttgccttggagagaccaaagccatcgagatcgatgaataaa
gttaggttcttcatttcacaaatgacctcacatactgcagggatctacacctgcttctat
cagagtggagagctctggtcaaagtcgagcaaccccctgaaactggtagtaactggtctg
tatgacacacccaacctctgggtttatccacagcctgaggtaaccttgggggagaatgtt
accttcttttgccaactgaagactgccacaagcaaattctttctgctcaaggagagagga
tccaaccacatccagaataaatatgggaacatccaagcagagtttcccatgggccccgtg
actagggctcacagagggacatacagatgttttggctcttacaacgactatgcatggtct
tttcccagtgagcctgtgacactactcatcacaggaggtgttgagaacagcagccttgca
cctaccgaccctacttcttctcttgattattgggagtttgacctttcaaccaatgaatca
ggattacaaaaggactccgccttctgggatcacacaacccagaatctcattcgaattggt
ctggcatgcataatcctgataactctagtatggcttttgactgaagactggctcagcaag
aggaaagatcatgaagaggccaacagattaacaaattgggaatgcaggagaagatggaga
atgcagcattactttgaagaggaacaaagaaatgcaatatctatgatggaactgaaggca
actcctggggccttgtga

DBGET integrated database retrieval system