KEGG   Mus musculus (mouse): 170930
Entry
170930            CDS       T01002                                 

Symbol
Sumo2, SUMO-2, Smt3A, Smt3b, Smt3h2
Name
(RefSeq) small ubiquitin-like modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    170930 (Sumo2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    170930 (Sumo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    170930 (Sumo2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    170930 (Sumo2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    170930 (Sumo2)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   170930 (Sumo2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    170930 (Sumo2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    170930 (Sumo2)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 170930
NCBI-ProteinID: NP_579932
MGI: 2158813
Ensembl: ENSMUSG00000020738
Vega: OTTMUSG00000003474
UniProt: P61957
Structure
Position
11:complement(115413935..115427056)
AA seq 95 aa
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgagaaacccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaatgaggcagatcagattc
cggtttgatgggcagccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccagcagcagactggaggtgtctactaa

DBGET integrated database retrieval system