KEGG   Mus musculus (house mouse): 170935
Entry
170935            CDS       T01002                                 
Symbol
Grid2ip
Name
(RefSeq) glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FH2 PDZ PDZ_6 Peptidase_M50 PDZ_2 RMI1_N
Other DBs
NCBI-GeneID: 170935
NCBI-ProteinID: NP_001152793
MGI: 2176213
Ensembl: ENSMUSG00000010825
UniProt: Q0QWG9
Position
5:143343085..143377534
AA seq 1203 aa
MPATNQGWPEDFGFQLGGSGPCFVIEVAEGSSAHAGGLRPGDQILEVEGLAVGGLSRERI
VRLARRCPRVPPSLGVLPGPEGGPTALTAAWLTRRFGRSLPLSRELLRLAGGPRPDAVHR
ERRRKAQEFSCQVDDILGDRLTAKEQVFTALKQFAAEQRVDELVWTLTLVLPSEAQGPVL
DNLRIFIPKKHRARFDEVVSQGLLGKLCRARRAQGAQRLRRSRSEERPERLLVSTRASAA
PRRPDEPPPRKATSLLGGRTGPGGPRRTVRVYKGNKSFGFTLRGHGPVWIESVLPGSPAE
NASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVVEEGPVPFASDSDSLDSPTR
ASALTSLQWVADILPSSIRVQGRTFSQQLDHLLTPPERYGVCRALERFFQHRNIDTLIVD
VYPVLDTPAKQVLWQFLYQLLTYEEQELCQEKIACFLGYTAMTEPESSLDLEPESTPEPT
PEPQPRSSLRASSMCRRSLRSQGLETSLSCGPGDCPEMPLPLIPGERQAGDGTSLPETPN
PKMMSAVYAELESRLNSSFKGKIGTMSKSRASPPVPSLVGTSGPRTLSGVSWPSDRLLPS
PCYDPLCSGGLASPSSSESHPYASLDSSRAPSPQPGLGSIHADSPPSPDPIRPPSRRKLF
AFSRPVRSRDTDRFLDALSEQLGPRLSIVDDFLTPENDYEEMSFHDDQGSFVTNERSSAS
ECVSSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDPKPSSRTSDGPRGPPQSLTKPL
TQINHPVPPPPPPPLPPPVPCAPPMLSRGVGHRRSETSHMSVKRLRWEQVENSEGTIWGQ
LGEDSDYDKLSDMVKYLDLELHFGTQKPPKPVPGPEPFRKKEVVEILSHKKAYNTSILLA
HLKLTPGELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRYQAFREAPGRLSEPDQFVL
QMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLELKNSRKLAKILEFVLAMGN
YLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKSLSQHFPELLGFAQDLPTV
PLAAKVNQRALTGDLADLHDTVSEIQVACQSMAPSSEDRFAVVMASFLETAQPALRALDG
LQREAMEELGKALAFFGEDSKATTSEAFFGIFSEFMSKFERALSDLQAGDGPRSSGMVSP
LAW
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgccagccaccaatcaaggctggcccgaggacttcggcttccagctgggcggctctggc
ccctgcttcgtgatagaggtggctgaaggaagcagcgcgcacgctggggggttgcggccg
ggggatcagatcctggaagtggaggggctggctgtgggtggcctgagccgagagcgcatc
gtgcgcttggcacggcgctgccctcgagtgccacccagcctcggtgtgctcccaggcccc
gagggtggccccacagccttgacagcagcctggctaacccggcgatttggccgcagcctc
ccgctgagccgcgaactgctgcgtttggctggtggtcccagaccagatgctgtgcacaga
gagcgcaggcgcaaggcccaggagttcagctgccaggtagatgacatcttgggggatcgg
ctgacagccaaggagcaggtgtttactgcactgaagcagttcgctgccgagcaacgggtg
gatgagctggtgtggaccctcactctcgtgctgcccagcgaggcccaggggccagtcctg
gacaacctcaggatctttattcccaaaaagcatcgggcgcgcttcgacgaggtggtgtcg
cagggtctgctgggcaagctgtgccgtgctcggagggcgcagggcgcacagcgtttgcgt
cggagccgcagcgaggagcgcccggagcgcctcttagtgtccacgcgcgctagcgccgct
ccccgccgtccggatgagccacccccgcggaaggcaacctcgctgctgggcggtcgcact
ggccctgggggtcctcgtaggacggttcgagtttataaaggcaacaagagtttcggcttc
actctgcgaggccatggaccggtctggatcgaatctgtcctgcctggcagcccggctgaa
aatgcctccctcaagtcaggtgaccggatcctcttcctcaatggattggacatgaggaac
tgctcccacgacaaggtggtgtccatgttgcagggcagtggcgccatgcccacgctggtg
gtagaggaaggaccggtccctttcgccagtgattcagattctctggattccccgacccgg
gcgtcagctctcacctcgctgcagtgggtggcggatatcctgccttccagtatccgagtc
caggggaggaccttcagccagcagctggaccacctcctcactcctcccgagcgctatgga
gtctgccgagctctcgagcgcttctttcagcacaggaacatcgataccctcatcgtggat
gtctaccccgtcctggacacacccgccaagcaggtactctggcagttcctctaccagctg
ctgacctacgaggagcaggagctgtgtcaggagaagatcgcgtgcttcctcggctacaca
gccatgacggaacctgaatcctcactggacctcgagccagagtctacaccagagcccaca
ccagagccacaaccacggagttccctgagggcctcttccatgtgccgtcgcagcttgcgc
tcccagggcctggagaccagcctcagctgtggtcctggtgactgccctgagatgccccta
cctctgatcccaggcgagcgtcaggctggcgatggcacatccctcccggaaacccctaac
cccaaaatgatgtcagcggtctatgcagagctcgagtctcgactgaacagcagcttcaaa
gggaagatagggaccatgtccaaatcccgggcctctccaccagtccccagcctggtcggc
acatcagggcccaggaccctgtctggagtctcctggcccagtgaccggctcctgccttcc
ccgtgctatgacccgctgtgttctgggggtctggcctctcccagcagctcggaatcccac
ccctacgccagcttggacagcagcagggcgccctccccacagccaggccttggatccatc
cacgccgacagccccccaagcccagaccccatccggccgcccagtcgccggaagctcttc
gccttctcacgcccagtccggagccgagacacagatcgcttcctggatgcgctgagcgag
cagctgggtccccgcctcagcatcgtggatgacttcctgacacccgagaatgactatgaa
gagatgagcttccatgatgaccagggcagctttgtgaccaacgagaggagcagcgctagc
gagtgtgtcagcagcagcgaggagggcagttctctgacctactcctccatctccgaccac
atccccccacctccactcagccccccgccgccaccgcccctgcctttccatgaccccaag
cctagctcccgcacctccgatggtccccgaggtccccctcagtcattgaccaaacccctc
acccagatcaaccatccagtcccacccccacccccaccccctctacccccacctgtgccc
tgtgcaccccccatgctatcccgaggcgtgggccaccgccgcagtgagaccagccatatg
agcgtcaagcgcttacgctgggaacaggtggagaactcagaaggcaccatctggggtcag
cttggggaagactctgactatgacaagctgagtgacatggtgaaatacctcgacctggag
ctccacttcggcacccagaaacctccgaagccagtgcccggcccggagcccttcaggaag
aaggaagtggtggagatcttgtcccacaagaaggcctacaatacctccattctcctagcg
cacctgaagctgacccctggcgagctgcggcaagtgctcatgagcatggaaccccggcgc
ctggagcctgctcatctggcgcagctgctgctcttcgctcctgacgccgacgaggaacag
cgatatcaggctttccgcgaggctccgggtcgcctcagtgagccggaccagttcgtcctg
cagatgctgtcggttcccgaatacaagacccgcctgcgcagtctacacttccaggctacc
ttgcaggagaagacagaggagatacgaggcagcctcgagtgtctgcgacaggcatctctg
gagctcaaaaacagccggaaactcgccaagatcctggagtttgtgttggccatgggtaac
tatctcaacgatggacagcccaagaccaacaagaccactggcttcaagatcaacttcctg
accgagctaaactccaccaagacagtggacgggaagtccacctttctgcacatccttgcc
aaatcgctaagccagcacttccctgagctcctgggctttgcccaggacctgcccactgtg
cccctggctgccaaagtgaaccagcgagccctgactggtgacctggctgacctccatgac
accgtcagtgagattcaggtggcctgccagagcatggccccttccagtgaggacaggttt
gctgtggtcatggcttcctttctggaaacagcgcagccagccctgcgagcgttggatggt
ctgcagcgagaggccatggaggagctagggaaggctctggccttcttcggagaggactcc
aaggccactacctcagaggccttctttggcatcttttcagaattcatgagcaaatttgag
agagccctcagcgacctgcaggcaggggatggcccacgcagctcagggatggtgtcaccc
ctggcctggtga

DBGET integrated database retrieval system