KEGG   Mus musculus (mouse): 17096Help
Entry
17096             CDS       T01002                                 

Gene name
Lyn, AA407514, Hck-2, p53Lyn, p56Lyn
Definition
(RefSeq) LYN proto-oncogene, Src family tyrosine kinase
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04611  Platelet activation
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04730  Long-term depression
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    17096 (Lyn)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    17096 (Lyn)
   04662 B cell receptor signaling pathway
    17096 (Lyn)
   04664 Fc epsilon RI signaling pathway
    17096 (Lyn)
   04666 Fc gamma R-mediated phagocytosis
    17096 (Lyn)
   04062 Chemokine signaling pathway
    17096 (Lyn)
  09156 Nervous system
   04730 Long-term depression
    17096 (Lyn)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    17096 (Lyn)
  09167 Infectious diseases
   05167 Kaposi sarcoma-associated herpesvirus infection
    17096 (Lyn)
   05169 Epstein-Barr virus infection
    17096 (Lyn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17096 (Lyn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17096 (Lyn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     17096 (Lyn)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   17096 (Lyn)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    17096 (Lyn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 17096
NCBI-ProteinID: NP_001104566
MGI: 96892
Ensembl: ENSMUSG00000042228
Vega: OTTMUSG00000004398
UniProt: P25911 Q3TCS3 Q8CEI0
Structure
PDB: 

Position
4 A1; 4 2.05 cM
AA seq 512 aa AA seqDB search
MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPVPEFHLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtattaaatcaaaaaggaaagacaatctcaatgacgatgaagtagattcgaag
actcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttcctgaatttcatcttttaccaggacagagatttcaaacaaaagat
ccagaggaacaaggtgacattgtggtggccttatacccttatgatggcatccacccagat
gacttgtccttcaagaaaggagaaaagatgaaagttctagaagagcatggggaatggtgg
aaagctaagtccctttcatcaaagagagaaggcttcatccccagcaactacgtggccaag
gtcaacaccttagaaactgaagagtggttcttcaaggacataacaaggaaagatgcagag
cgacagcttctggcaccagggaacagtgcaggagctttccttatcagagaaagcgaaact
ttaaagggaagcttctctctttctgtcagagattatgaccctatgcatggtgatgtcatt
aagcactacaaaattagaagtctggacaatggtggctattacatctctcctcgcatcact
tttccctgcatcagtgacatgattaagcattaccaaaagcagtctgatggtctatgcaga
agactggagaaggcatgcatcagtcccaaacctcagaagccatgggataaagatgcctgg
gagatcccccgggagtccattaagttggtgaaaaagcttggcgcagggcagtttggggaa
gtctggatgggttactataacaacagcacaaaggtggctgtgaagaccctcaagcccggc
accatgtctgtgcaggcattcctggaagaggccaacctcatgaagaccttgcaacatgac
aagctagtgcggctgtacgctgtggtcaccaaggaggagcccatctacatcatcaccgag
ttcatggctaagggtagtttgctggatttcctcaagagtgatgaaggtggcaaggtgctg
ctgcccaagctcattgacttctcggcccagattgcagaaggcatggcgtacatcgagcgg
aagaactacatccaccgtgatctgcgagctgctaacgtcctggtctctgagtcactcatg
tgcaagattgcagactttggcctcgcgagagtcatcgaagataacgagtacacagcaagg
gaaggtgcgaagttccctatcaagtggacagctccagaggccatcaacttcggctgcttc
actatcaaatctgacgtgtggtccttcggaattctcctgtatgagattgtcacctatggg
aagattccctacccagggagaaccaacgcagatgtgatgagcgcactgtcacagggatat
cgaatgccacgcatggagaactgcccagatgagctctatgacatcatgaaaatgtgttgg
aaagaaaaggcagaggagaggccaacttttgactacttacagagtgtcctggatgacttc
tatacagccacagaagggcagtatcagcagcaaccgtag

DBGET integrated database retrieval system