KEGG   Mus musculus (house mouse): 17110
Entry
17110             CDS       T01002                                 
Symbol
Lyz1, Lyz, Lyzf3, Lzp-s
Name
(RefSeq) lysozyme 1
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    17110 (Lyz1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17110 (Lyz1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     17110 (Lyz1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17110 (Lyz1)
SSDB
Motif
Pfam: Lys SLT SLT_3 Destabilase Phage_lysozyme2
Other DBs
NCBI-GeneID: 17110
NCBI-ProteinID: NP_038618
MGI: 96902
Ensembl: ENSMUSG00000069515
UniProt: P17897 A0A077S9N1
Position
10:complement(117123700..117128773)
AA seq 148 aa
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggctctcctgactctgggactcctcctgctttctgtcactgcccaggccaaggtc
tacaatcgttgtgagttggccagaattctgaaaaggaatggaatggatggctaccgtggt
gtcaagctggctgactgggtgtgtttagctcagcatgagagcaattataacacacgagct
acaaactacaaccgtggagaccgaagcaccgactatgggatatttcagatcaatagccga
tactggtgtaatgatggcaaaaccccaagatctaagaatgcctgtgggatcaattgcagt
gctctgctgcaggatgacatcactgcagccatacaatgtgcaaagagggtggtgagagat
ccccaaggcattcgagcatgggtggcatggcgaacacaatgtcaaaaccgagatctgtcc
cagtatattcggaactgcggagtctga

DBGET integrated database retrieval system