KEGG   Mus musculus (mouse): 17112
Entry
17112             CDS       T01002                                 

Symbol
Tm4sf1, L6, M3s1
Name
(RefSeq) transmembrane 4 superfamily member 1
  KO
K24918  transmembrane 4 L6 family member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    17112 (Tm4sf1)
SSDB
Motif
Pfam: L6_membrane CD20
Other DBs
NCBI-GeneID: 17112
NCBI-ProteinID: NP_032562
MGI: 104678
Ensembl: ENSMUSG00000027800
Vega: OTTMUSG00000052837
UniProt: Q64302
Position
3; 3 D
AA seq 202 aa
MCYVKCARYIGYSLVWAAVFCIVANALLYFPNGETKYATEDHLSRFVWYFAGIVGGGLLM
LLPAFVFIGMDEEDCCGCCGYENYGKRCSMLSSVLAALIGIVGSAYCVIVASLGLAEGPK
CSDAHGVWNYTFASTEGQYLLNSSMWSKCYEPKHIVEWHVTLFSILLAFAAVEFILCLIQ
VINGMLGGLCGYCCSRQQQYNC
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtgctacgtaaagtgtgcaagatacatcggatactctctggtgtgggctgctgtcttc
tgcatcgtagctaatgctttgctctactttcctaatggggagacaaagtatgctacggag
gaccacctcagccgtttcgtgtggtattttgccggcattgtaggcggaggcctgctgatg
ctcctgccagcgtttgtgttcattgggatggatgaagaggactgctgtggttgctgcggc
tacgaaaactacggcaagcgatgctcgatgctttcttctgtactggctgctctgattgga
atcgtgggatctgcttactgtgtcattgtggcatcactgggtttggcagaaggaccaaag
tgcagcgatgcccatggagtatggaactacacctttgccagcactgagggacagtacctt
ctgaattcctctatgtggtccaagtgctatgagcccaagcatattgtggagtggcatgtg
actctattttctatcctcttggcttttgccgcagttgaattcatcttgtgtctcattcaa
gtaataaatggaatgcttggaggcttatgtggctattgctgctctcgccaacagcaatat
aactgctaa

DBGET integrated database retrieval system