KEGG   Mus musculus (mouse): 17116
Entry
17116             CDS       T01002                                 

Gene name
Mab21l1, AW047968
Definition
(RefSeq) mab-21-like 1
  KO
K23092  putative nucleotidyltransferase [EC:2.7.7.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    17116 (Mab21l1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     17116 (Mab21l1)
Motif
Pfam: Mab-21
Other DBs
NCBI-GeneID: 17116
NCBI-ProteinID: NP_034880
MGI: 1333773
Ensembl: ENSMUSG00000056947
Vega: OTTMUSG00000053042
UniProt: O70299
Position
3; 3 C
AA seq 359 aa
MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMD
NRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS
GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIW
PRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR
LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRL
NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatcgcggcccaggccaagctggtctaccacctgaataagtactacaacgagaaatgc
caggccaggaaagctgccatcgccaaaaccatccgggaagtctgcaaagtggtctccgac
gtcctgaaggaggttgaagtgcaggaaccgcgtttcatcagctccctcaatgagatggac
aaccgctacgagggcctggaggttatctctcccaccgagttcgaggtggtactctatctg
aaccagatgggggtgtttaacttcgtggacgacggctccctgcctggctgtgcggtgctg
aaactgagcgatgggcgcaagaggagcatgtccctctgggtggaattcatcaccgcctct
ggctacctctcggcacgcaaaatccgttccaggtttcagacactggtggctcaggcggtg
gacaagtgtagctacagagatgtagtaaagatggtggctgacacgagcgaagtgaaactg
agaatccgagataggtatgtggtgcagatcaccccggcctttaaatgcaccgggatttgg
ccgcggagtgctgcccactggccgcttccccacatcccctggccaggacccaaccgggtg
gcagaggttaaggctgaagggttcaatttgttgtccaaggagtgccactccctggccggc
aagcagagttcggctgagagcgatgcttgggtgctgcagtttgcagaggccgagaacaga
ctgcagatggggggctgcaggaagaaatgcctctctatcctgaaaaccctgcgtgatcgc
cacctggagttgccaggccagcccctgaacaactaccacatgaagactctggtgtcctac
gagtgcgagaagcatcctcgagagtcggactgggacgaatcttgcctgggcgatcggctg
aacggaattcttctgcagctcatctcatgcctgcagtgccggcggtgtccccattacttc
ttaccgaacttagatctgtttcaaggcaaaccccactcggccttggaaaacgctgctaaa
caaacgtggcgactggcaagagagatcctgaccaacccaaaaagtttggaaaaactttag

DBGET integrated database retrieval system