KEGG   Mus musculus (mouse): 171168
Entry
171168            CDS       T01002                                 

Gene name
Acer1, 2310024P18Rik, AI662009, Alkcdase1, As, Asah3, Cer, Cer1
Definition
(RefSeq) alkaline ceramidase 1
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Module
mmu_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    171168 (Acer1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    171168 (Acer1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     171168 (Acer1)
SSDB
Motif
Pfam: Ceramidase
Other DBs
NCBI-GeneID: 171168
NCBI-ProteinID: NP_783858
MGI: 2181962
Ensembl: ENSMUSG00000045019
UniProt: Q8R4X1
Position
17; 17 D
AA seq 273 aa
MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY
AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK
FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH
LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY
EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgcatgtaccgggcaccagagcaaagatgtccagcatctttgcctatcagagttctgag
gtggattggtgtgagagtaatttccagcactcagagttggtggccgagttctacaatacg
ttcagcaatgtgttcttcctcatctttggacccctcatgatgttcctcatgcatccgtat
gcccagaagcgtacccggtgtttctatggagtgtcagtcctcttcatgctcataggtctg
ttctccatgtatttccacatgacactcagctttctgggacagctgctggatgagatctcc
atcctgtggttgttggccagtggatacagtgtgtggctgccccgttgctattttcccaag
ttcgtcaaggggaacaggttctacttcagctgcctggtaactataaccactattatcagc
accttcttgacgttcgtgaagcccacagtcaatgcatatgctctcaacagcatcgccatc
cacatcctctacattgtgcgcacagagtacaagaagattagggatgatgatcttcggcat
ctgattgcggtttctgtggtcttatgggccgctgcactgaccagctggatcagtgaccgt
gtactttgcagcttctggcagcggattcacttctactacctgcacagcatttggcacgtc
ctcataagcatcacatttccttatggtatcgtgaccatggccctggtggatgcaaagtat
gagatgccagataaaaccctcaaagtccactactggccccgggacagctgggtcatcggg
ctaccctatgtggagatccaggagaatgacaagaactgctga

DBGET integrated database retrieval system