KEGG   Mus musculus (mouse): 17117
Entry
17117             CDS       T01002                                 

Gene name
Amacr, Mac, Macr1
Definition
(RefSeq) alpha-methylacyl-CoA racemase
  KO
K01796  alpha-methylacyl-CoA racemase [EC:5.1.99.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    17117 (Amacr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    17117 (Amacr)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.4  alpha-methylacyl-CoA racemase
     17117 (Amacr)
SSDB
Motif
Pfam: CoA_transf_3 TAL_effector
Other DBs
NCBI-GeneID: 17117
NCBI-ProteinID: NP_032563
MGI: 1098273
Ensembl: ENSMUSG00000022244
UniProt: O09174
Position
15; 15 A1
AA seq 381 aa
MVLRGVRVVELAGLAPGPFCGMVLADFGAEVVRVNRLGSTGENFLARGKRSLALDLKRSQ
GVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFSKVAG
HDINYLALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGIVLALFERTRSGRGQVID
SSMVEGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTYKTADGEFMAVGAIEPQFY
ALLLKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFE
EALHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAKRDPSVGEHTVEVLREYGFSQ
EEILQLHSDRIVESDKLKANL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggtgctgcgtggcgtcagggttgtggagctggcaggcctggccccggggccgttctgc
ggaatggtcctggcggacttcggcgccgaggtggtgcgcgtgaaccggctgggctccacg
ggcgagaattttctggcccgaggcaagcgctcgctagcgctggacctgaagcgctctcag
ggagtcacggtgttgcggcgcatgtgcgcacgcgcggacgtgttgctggagcccttccgc
tgcggtgtcatggagaaactccagcttgggccagagactctactgcaggacaatccaaag
ctcatctatgccaggctgagcggatttggccaatcgggaattttctccaaagtagctggc
catgacatcaactatttggctttatcaggcgttctgtcaaagattggcagaagcggtgag
aacccctacccaccgctgaatctcctggctgactttggcggtggaggcctcatgtgcaca
ctgggcattgtgctggctctctttgaacgcacacgctctggccgagggcaggtcatcgat
tcaagcatggtggaagggactgcatacttaagttctttcctgtggaaaacccagcccatg
ggtctgtggaaacagcctcgaggacaaaacatcttagatggcggtgcacctttctacaca
acctacaagacggcagacggggagttcatggctgtaggtgccatagaaccccagttctat
gcactgctgcttaaaggacttggactcgagtctgaggaactcccctcccagatgagctca
gcagattggccagagatgaagaagaaatttgcagatgtgtttgcaaagaagactaaggca
gaatggtgccagatctttgacgggacagatgcgtgtgtgaccccagtgctgacgtttgag
gaggccctccaccaccagcacaacagagaacgggcctccttcatcactgatggggagcag
ctcccgagcccccgccctgcacctctgctttccagaactcctgccgtcccatctgccaaa
agggacccttctgtaggggagcacaccgtagaagtgcttagagagtatggattcagtcag
gaagagatccttcagctgcactcagatagaatcgttgaaagtgataagctaaaagccaat
ctctga

DBGET integrated database retrieval system