KEGG   Mus musculus (house mouse): 171188
Entry
171188            CDS       T01002                                 
Symbol
Vmn1r32, V1rc15
Name
(RefSeq) vomeronasal 1 receptor 32
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    171188 (Vmn1r32)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    171188 (Vmn1r32)
SSDB
Motif
Pfam: V1R
Other DBs
NCBI-GeneID: 171188
NCBI-ProteinID: NP_598931
MGI: 2159451
Ensembl: ENSMUSG00000062905
UniProt: Q8R2D9
Position
6:complement(66529167..66536692)
AA seq 302 aa
MFSLNNVLYFQVGLGTLANIFLLFFYTIIILCHRSKPMDLISCQLTFVHIMMFLTGGDIW
LTDLFESLNIENDFKCKATFYINRVMRGLSICITCLLSVFQAVTISPNTSLLAKFKHKLK
KYMIFSFFYFWSFNLSFSSNRIFYVGAYTNMSETNQLKVTKYCSLFPMNYIIRGLILTMT
TSRDVFLVGVMLTTSAYMVIILFRHQRQCKHLHSNSHLRASPEKRATQIILLLVVFFVVM
YWVDFIISSTSVLLWMYDPVILTVQKFVMNAYPTITPLIQIISDNRMIITLKNMQKICHQ
IF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgttttcattaaataatgtcctttatttccaagttggacttggaaccctggccaatata
tttcttctttttttctacactatcataatcctatgtcacagatctaagcccatggacttg
atctcctgtcaactgaccttcgttcacataatgatgtttctcactggaggggatatttgg
cttacagacttatttgagtcactgaacattgagaatgacttcaaatgcaaggcaactttt
tacataaacagggtgatgagaggcctctctatctgcatcacctgtctcctgagtgtgttc
caggctgtgacaatcagtcccaatacctctttgttggcaaaatttaaacataaactaaaa
aaatacatgatcttttctttcttctatttttggtctttcaatttgtcattcagcagtaac
cggatcttctatgttggtgcttataccaacatgagtgagaccaaccagttgaaggtcact
aaatactgctcactcttccccatgaactacatcatcaggggactgattttaacaatgaca
acctccagagacgtatttcttgtaggggtcatgctgaccacaagtgcatatatggtgatt
atcttgttcagacatcagaggcaatgcaagcatcttcatagcaacagccacttacgagct
tcccctgagaaaagggccacccagatcatcttgctgctggtggttttctttgtggtcatg
tactgggtggacttcatcatctcatccacctcagtcctgttatggatgtatgacccagtc
atcctgactgttcagaagtttgtcatgaatgcctatcccacaattactcctttgatacaa
atcatttctgataaccgaatgatcatcacactgaaaaacatgcagaaaatatgccaccag
attttttaa

DBGET integrated database retrieval system