KEGG   Mus musculus (mouse): 17120
Entry
17120             CDS       T01002                                 

Gene name
Mad1l1, AI173502, AW550425, Mad1
Definition
(RefSeq) MAD1 mitotic arrest deficient 1-like 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17120 (Mad1l1)
   04114 Oocyte meiosis
    17120 (Mad1l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17120 (Mad1l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    17120 (Mad1l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17120 (Mad1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    17120 (Mad1l1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     17120 (Mad1l1)
SSDB
Motif
Pfam: MAD TSC22 DUF4200 DUF2856
Other DBs
NCBI-GeneID: 17120
NCBI-ProteinID: NP_034882
MGI: 1341857
Ensembl: ENSMUSG00000029554
Vega: OTTMUSG00000030671
UniProt: Q9WTX8
Position
5 G2; 5 78.82 cM
AA seq 717 aa
MEDLGENTTVLSSLRSLNNFISQRMEGTSGLDVSTSASGSLQKQYEYHMQLEERAEQIRS
KSYLIQVEREKMQMELSHKRARVELERAASTNARNYEREVDRNQELLARIRQLQECEATA
EEKMREQLERHRLCKQNLDAVSQQLREQEDSLASAREMISSLKGRVSELQLSAMDQKVQV
KRLESEKQELKEQLELQQRKWQEANQKIQELQASQDERAEHEQKIKDLEQKLCLQEQDAA
VVKSMKSELMRMPRMERELKRLHEENTHLREMKETNGLLTEELEGLQRKLSRQEKMQEAL
VDLELEKEKLLAKLQSWENLDQTMGLNLRTPEDLSRFVVELQQRELTLKEKNNSITSSAR
GLEKVQQQLQDEVRQANAQLLEERKKRETHEALARRLQKRNALLTKERDGMRAILGSYDS
ELTQTEYSTQLTQRLWEAEDMVQKVHAHSSEMEAQLSQALEELGVQKQRADTLEMELKML
KAQTSSAESSFSFCKEEVDALRLKVEELEGERSRLEQEKQVLEMQMEKLTLQGDYNQSRT
KVLHMSLNPISMARQRQHEDHDRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEV
AELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTD
CLIFKATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIPAFLSALTIELFSRQTSI
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagacctcggggagaacaccacagtcctctcctccctgagatctctgaacaacttc
atttctcagcgaatggagggaacatcaggcctggatgtgtccacgtctgcctcagggtcc
ctacagaagcagtatgagtatcacatgcagctggaggaaagagcagagcagatccgctca
aagtcctacctcatccaagtggagcgggagaagatgcagatggagctgagccacaagaga
gcccgagtggagctggagagagcagccagcaccaatgccaggaactacgagcgcgaggta
gatcgcaaccaggagctcctggcacgcattcgacagctccaggagtgtgaggccacagca
gaagagaagatgcgggagcagctggagcgccacaggctgtgcaagcaaaacctggatgct
gtcagtcagcagctgcgggaacaggaggacagcctggcttcggccagggagatgattagt
tcattgaaggggcgtgtctcggagctgcagttgagtgccatggaccagaaggtacaggtc
aagcggctggagtctgaaaagcaggagctgaaggagcagctggagctgcagcagcggaaa
tggcaagaggcaaatcagaagatccaggagctgcaggccagtcaagatgagagagctgag
catgagcagaagattaaggacctggagcagaagctgtgtctacaagagcaggatgcagct
gtggtgaagagcatgaagtctgagctgatgcggatgcccaggatggagcgtgagctgaag
aggctgcatgaagagaacactcatctaagggagatgaaggagaccaatgggctgctcaca
gaggagctggaaggtctgcagaggaaactgagccggcaggagaagatgcaggaggctctg
gttgacctggagttggaaaaggagaagctacttgcaaagctgcagagctgggagaacctg
gaccagaccatgggcttgaatctcaggactccagaggacctttctaggttcgtggttgag
ctacagcagcgagagctcaccctgaaggagaagaataacagcatcaccagcagtgcccgg
ggtctggagaaggtccagcagcagctccaggatgaggtccggcaggccaatgcacagctg
ctggaggagcggaaaaagagggagacacatgaggcacttgcccgaaggctccagaagcgc
aatgcattgctgaccaaggagagagatggcatgcgtgccatcctgggatcctacgacagt
gagctgacccaaactgagtactcaacccagctgacacagcgcctgtgggaggccgaggac
atggttcagaaggtacatgcccacagctcggagatggaggctcagctgtctcaggccctg
gaggagcttggggttcagaagcagagagctgacacgctggagatggagttgaagatgctg
aaggcccagacaagctcagctgaatctagcttctcattctgcaaagaggaggtggatgca
ctcaggttgaaggtggaggagctggagggtgagcggagccgtctggaacaggaaaagcag
gtgctggagatgcagatggagaaactaaccctacagggtgactacaaccagagtcgaacc
aaagtgctacacatgagccttaacccaatcagcatggccaggcaacgccagcatgaggac
catgaccggctgcaggaggaatgtgagcgcttacggggacttgtgcatgccctggagaga
gggggccccatccctgctgacctggaggctgcctccagtctgccctcatcaaaggaggtg
gcagagctgcggaagcaggtggaaagtgctgagctgaagaaccagcggctgaaggaggtt
ttccagaccaagatccaggagttccgcaaagtttgctacacgctgaccggctaccagatt
gacgtgaccacggagagccaataccgcctcacctcccgatacgctgagcaccagacggac
tgcctcatcttcaaggccacaggaccctcgggctccaagatgcagctgctggagacagag
ttctcacggtctgtgcctgagctcattgaactgcacttgctgcagcaggacagcatccct
gccttcctcagtgcgctcaccatagagctgttcagccgccagacctctatctag

DBGET integrated database retrieval system