KEGG   Mus musculus (mouse): 17120
Entry
17120             CDS       T01002                                 

Gene name
Mad1l1, AI173502, AW550425, Mad, Mad1
Definition
(RefSeq) MAD1 mitotic arrest deficient 1-like 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17120 (Mad1l1)
   04114 Oocyte meiosis
    17120 (Mad1l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17120 (Mad1l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    17120 (Mad1l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17120 (Mad1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    17120 (Mad1l1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     17120 (Mad1l1)
SSDB
Motif
Pfam: MAD TSC22 DUF4200 DUF2856
Other DBs
NCBI-GeneID: 17120
NCBI-ProteinID: NP_034882
MGI: 1341857
Ensembl: ENSMUSG00000029554
Vega: OTTMUSG00000030671
UniProt: Q9WTX8
Position
5 G2; 5 78.82 cM
AA seq 717 aa
MEDLGENTTVLSSLRSLNNFISQRMEGTSGLDVSTSASGSLQKQYEYHMQLEERAEQIRS
KSYLIQVEREKMQMELSHKRARVELERAASTNARNYEREVDRNQELLARIRQLQECEATA
EEKMREQLERHRLCKQNLDAVSQQLREQEDSLASAREMISSLKGRVSELQLSAMDQKVQV
KRLESEKQELKEQLELQQRKWQEANQKIQELQASQDERAEHEQKIKDLEQKLCLQEQDAA
VVKSMKSELMRMPRMERELKRLHEENTHLREMKETNGLLTEELEGLQRKLSRQEKMQEAL
VDLELEKEKLLAKLQSWENLDQTMGLNLRTPEDLSRFVVELQQRELTLKEKNNSITSSAR
GLEKVQQQLQDEVRQANAQLLEERKKRETHEALARRLQKRNALLTKERDGMRAILGSYDS
ELTQTEYSTQLTQRLWEAEDMVQKVHAHSSEMEAQLSQALEELGVQKQRADTLEMELKML
KAQTSSAESSFSFCKEEVDALRLKVEELEGERSRLEQEKQVLEMQMEKLTLQGDYNQSRT
KVLHMSLNPISMARQRQHEDHDRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEV
AELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTD
CLIFKATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIPAFLSALTIELFSRQTSI
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagacctcggggagaacaccacagtcctctcctccctgagatctctgaacaacttc
atttctcagcgaatggagggaacatcaggcctggatgtgtccacgtctgcctcagggtcc
ctacagaagcagtatgagtatcacatgcagctggaggaaagagcagagcagatccgctca
aagtcctacctcatccaagtggagcgggagaagatgcagatggagctgagccacaagaga
gcccgagtggagctggagagagcagccagcaccaatgccaggaactacgagcgcgaggta
gatcgcaaccaggagctcctggcacgcattcgacagctccaggagtgtgaggccacagca
gaagagaagatgcgggagcagctggagcgccacaggctgtgcaagcaaaacctggatgct
gtcagtcagcagctgcgggaacaggaggacagcctggcttcggccagggagatgattagt
tcattgaaggggcgtgtctcggagctgcagttgagtgccatggaccagaaggtacaggtc
aagcggctggagtctgaaaagcaggagctgaaggagcagctggagctgcagcagcggaaa
tggcaagaggcaaatcagaagatccaggagctgcaggccagtcaagatgagagagctgag
catgagcagaagattaaggacctggagcagaagctgtgtctacaagagcaggatgcagct
gtggtgaagagcatgaagtctgagctgatgcggatgcccaggatggagcgtgagctgaag
aggctgcatgaagagaacactcatctaagggagatgaaggagaccaatgggctgctcaca
gaggagctggaaggtctgcagaggaaactgagccggcaggagaagatgcaggaggctctg
gttgacctggagttggaaaaggagaagctacttgcaaagctgcagagctgggagaacctg
gaccagaccatgggcttgaatctcaggactccagaggacctttctaggttcgtggttgag
ctacagcagcgagagctcaccctgaaggagaagaataacagcatcaccagcagtgcccgg
ggtctggagaaggtccagcagcagctccaggatgaggtccggcaggccaatgcacagctg
ctggaggagcggaaaaagagggagacacatgaggcacttgcccgaaggctccagaagcgc
aatgcattgctgaccaaggagagagatggcatgcgtgccatcctgggatcctacgacagt
gagctgacccaaactgagtactcaacccagctgacacagcgcctgtgggaggccgaggac
atggttcagaaggtacatgcccacagctcggagatggaggctcagctgtctcaggccctg
gaggagcttggggttcagaagcagagagctgacacgctggagatggagttgaagatgctg
aaggcccagacaagctcagctgaatctagcttctcattctgcaaagaggaggtggatgca
ctcaggttgaaggtggaggagctggagggtgagcggagccgtctggaacaggaaaagcag
gtgctggagatgcagatggagaaactaaccctacagggtgactacaaccagagtcgaacc
aaagtgctacacatgagccttaacccaatcagcatggccaggcaacgccagcatgaggac
catgaccggctgcaggaggaatgtgagcgcttacggggacttgtgcatgccctggagaga
gggggccccatccctgctgacctggaggctgcctccagtctgccctcatcaaaggaggtg
gcagagctgcggaagcaggtggaaagtgctgagctgaagaaccagcggctgaaggaggtt
ttccagaccaagatccaggagttccgcaaagtttgctacacgctgaccggctaccagatt
gacgtgaccacggagagccaataccgcctcacctcccgatacgctgagcaccagacggac
tgcctcatcttcaaggccacaggaccctcgggctccaagatgcagctgctggagacagag
ttctcacggtctgtgcctgagctcattgaactgcacttgctgcagcaggacagcatccct
gccttcctcagtgcgctcaccatagagctgttcagccgccagacctctatctag

KEGG   Mus musculus (mouse): 56150
Entry
56150             CDS       T01002                                 

Gene name
Mad2l1, AA673185, MAD, MAD2
Definition
(RefSeq) MAD2 mitotic arrest deficient-like 1
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56150 (Mad2l1)
   04114 Oocyte meiosis
    56150 (Mad2l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    56150 (Mad2l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    56150 (Mad2l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56150 (Mad2l1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     56150 (Mad2l1)
SSDB
Motif
Pfam: HORMA ATG101 AA_kinase bacHORMA_2
Other DBs
NCBI-GeneID: 56150
NCBI-ProteinID: NP_062372
MGI: 1860374
Ensembl: ENSMUSG00000029910
Vega: OTTMUSG00000023406
UniProt: Q9Z1B5 Q5HZH8
Position
6 C1; 6 30.56 cM
AA seq 205 aa
MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPE
LIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEE
VRLRSFTTTIHKVNSMVAYKTPVND
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcacagcagctcgcccgagagcaaggcatcaccctgcgtgggagcgcagaaatcgtg
gccgagtttttctcatttggcatcaacagcattttgtatcagcgtggcatttatccgtcg
gaaacctttactagagtgcagaaatatggactcaccttgcttacaactactgaccccgag
ctcataaagtatctcaataatgtggtggaacagctaaaagagtggctgtacaagtgctca
gttcagaaactggtggtggtcatctcaaatattgaaagtggtgaagtccttgaaagatgg
cagtttgatattgagtgtgacaaaactgcaaaagaggaaggtgttcgtagagaaaagtcc
cagaaagccatacaggatgaaattcgctcagtgattagacagattacagctactgtgaca
tttctgccactgttggaagtttcttgttcctttgatctgctgatttacactgacaaagac
ttggtggtacctgaaaagtgggaagaatcgggaccgcaatttattaccaattgtgaagaa
gtccgtctacgctcatttacaaccacaatccataaagtgaatagtatggtggcctacaaa
acccctgtcaatgactga

KEGG   Mus musculus (mouse): 71890
Entry
71890             CDS       T01002                                 

Gene name
Mad2l2, 2310033C13Rik, G1-453-4, MAD2, MAD2B, RE, REV7, rep, repro22
Definition
(RefSeq) MAD2 mitotic arrest deficient-like 2
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    71890 (Mad2l2)
   04114 Oocyte meiosis
    71890 (Mad2l2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    71890 (Mad2l2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    71890 (Mad2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    71890 (Mad2l2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     71890 (Mad2l2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 71890
NCBI-ProteinID: NP_001292349
MGI: 1919140
Ensembl: ENSMUSG00000029003
Vega: OTTMUSG00000010954
UniProt: Q9D752
Structure
PDB: 
6EKJ 6EKL 5O8K 4FJO 6EKM

Position
4; 4 E2
AA seq 211 aa
MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKNS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccaccctcacgcgccaagacctcaactttggccaagtggtggctgacgtgctctcc
gagttcctggaggtggccgtgcacctgattctctatgtgcgcgaggtctacccggtgggc
atcttccagaagcgcaagaagtacaacgtgccggttcagatgtcctgtcacccggagctg
aaccagtacatccaggacacactccactgcgtcaaacctctcctggagaagaacgatgtg
gagaaggtggtggtggtgattttggataaggaacaccgcccagtggagaagtttgtcttt
gagatcactcagcctcccttgctgtccatcaattcagactccctcctgtctcatgtggag
cagctgcttcgagccttcatccttaagattagtgtgtgtgatgctgtcctggatcacaac
cctccaggctgcacatttacagtcctcgtgcacacaagagaagctgctactcgaaacatg
gagaagatacaggtcatcaaggacttcccatggatcctggcagatgaacaggatgtccac
atgcacgacccccgcttgatacccctaaaaaccatgacgtcggacattttaaagatgcag
ctctacgttgaagagcgagcgcataagaacagctga

DBGET integrated database retrieval system