KEGG   Mus musculus (house mouse): 171201
Entry
171201            CDS       T01002                                 
Symbol
Vmn1r21, V1rc28
Name
(RefSeq) vomeronasal 1 receptor 21
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    171201 (Vmn1r21)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    171201 (Vmn1r21)
SSDB
Motif
Pfam: V1R Hormone_recep
Other DBs
NCBI-GeneID: 171201
NCBI-ProteinID: NP_598944
MGI: 2159464
Ensembl: ENSMUSG00000115343
UniProt: Q8R2C6
Position
6:complement(57820549..57821442)
AA seq 297 aa
MSSSNTVLYFQAGFGVLVNMFLLFFYTFIILCHRPKPMDLFSCQLTFIHIMMILTGGDTL
LADILESLKFGNDIKCKTVFYINRVMRGLSICITCLLSVFQAVTISPNTFLFAKFKQKLK
KYMMYAFFYLWSFNVLFSSRWFFYVAGFTNMSETHQMKVSKSCFLYPVNHIIRGLMLTVA
MSRDVFLVGVMMTTSTYMVIILFRHQRQCKHLHSISNLRGSPEKRATQIILLLVVFFVVM
YWVDFIISFTSILLWAYDPVVLTVQMFVMNIYPTITPVVQISSDKRIINVLKNLRSE
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtcctcatcaaatactgtcctttacttccaagctggatttggagtcctagtcaatatg
tttcttctttttttctatactttcataatactatgccacagacctaagcccatggacctg
ttctcctgtcaactaaccttcattcatataatgatgattctcactggtggggacactttg
cttgcagacatattagagtcactaaaatttgggaatgacatcaaatgtaagacagtattt
tacataaacagggtgatgagaggcctctctatctgcatcacctgcctcctgagtgtgttc
caggctgtcacaatcagtcccaataccttcttgtttgcaaaatttaaacaaaaactaaaa
aaatacatgatgtatgcttttttctatctttggtccttcaatgtattattcagtagtaga
tggttcttctacgttgctggttttaccaatatgagtgagactcaccagatgaaggtctct
aaatcctgctttctctaccccgtgaaccacatcatcaggggattgatgttaacagtggca
atgtctagagatgtttttcttgtaggtgtcatgatgaccacaagtacatacatggtgatt
attttgttcagacatcaaaggcaatgcaagcatcttcatagcatcagcaacctgagagga
tcccctgaaaaaagggccacccagataatcttgctcctggtagttttctttgtggtcatg
tactgggtggacttcatcatttcattcacttcaatcctgttatgggcatatgacccagtt
gtcctgactgttcaaatgtttgtgatgaatatctatcctacaattactcctgtggtacaa
atcagttcagataagagaataatcaatgtgctgaaaaacttgaggtcagaatga

DBGET integrated database retrieval system