KEGG   Mus musculus (mouse): 171209
Entry
171209            CDS       T01002                                 

Gene name
Asic3, AW742291, Acc, Accn3, DR, DRASIC, SLNAC1, TNAC1
Definition
(RefSeq) acid-sensing (proton-gated) ion channel 3
  KO
K04830  acid-sensing ion channel 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    171209 (Asic3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    171209 (Asic3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   171209 (Asic3)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 171209
NCBI-ProteinID: NP_892045
MGI: 2159339
Ensembl: ENSMUSG00000038276
Vega: OTTMUSG00000053655
UniProt: Q6X1Y6
Position
5; 5 A3
AA seq 530 aa
MKPPSGLEEAQRRQASDIRVFANSCTMHGLGHIFGPGGLTLRRGLWATAVLLSLAAFLYQ
VAERVRYYGEFHHKTTLDERESHQLTFPAVTLCNINPLRRSRLTPNDLHWAGTALLGLDP
AEHAAYLRALGQPPAPPGFMPSPTFDMAQLYARAGHSLEDMLLDCRYRGQPCGPENFTVI
FTRMGQCYTFNSGAQGAELLTTPKGGAGNGLEIMLDVQQEEYLPIWKDMEETPFEVGIRV
QIHGQEEPPAIDQLGFGAAPGHQTFVSCQQQQLSFLPPPWGDCNTASVDPDFDPEPSDPL
GSPSSSPPYSLIGCRLACESRYVARKCGCRMMHMPGNSPVCSPQQYKDCASPALDAMLRK
DTCVCPNPCATTRYAKELSMVRIPSRASARYLARKYNRSETYITENVLVLDIFFEALNYE
AVEQKAAYEVSELLGDIGGQMGLFIGASLLTILEILDYLCEVFQDRVLGYFWNRRSSQRR
SGNTLLQEELNGHRTHVPHLSLGPRPPTAPSAVTKTLAASHRTCYLVTRL
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaaacctccctcaggactggaggaggcccagcggcgacaggcctcagacatccgggtg
ttcgccaacagctgcacgatgcatggtttgggccacatctttggccctggaggcctgacc
ctgcgccgtgggctgtgggccacagctgtactcctgtcgctggcggccttcctctaccag
gtggctgagcgggttcgctactatggggagttccaccataagaccaccctggatgagcgt
gagagccaccagcttaccttcccagctgtcactttgtgtaacatcaatcccctgcgccgc
tcacgcctcacacccaatgacttgcactgggccggaacggcactgctgggtctggaccct
gctgaacatgctgcctaccttcgtgccctgggccagccccctgcaccacctggcttcatg
cccagtccgacttttgacatggcacaactctacgccagagccggccactcccttgaggac
atgttgctggactgccgataccgtggccagccctgtggacctgagaacttcacagtgatt
ttcactcgaatggggcaatgctacaccttcaactctggtgcccagggggcagagctgctc
accactcctaagggcggtgctggcaatggactggagattatgctggatgtacagcaggag
gagtatctgcccatctggaaggacatggaagagaccccatttgaggtggggatccgagtg
cagatccacggccaggaggaaccccctgccattgaccagctgggcttcggtgctgcccca
ggccaccagacttttgtgtcctgccagcaacagcaactgagtttcctgccaccaccctgg
ggtgactgcaataccgcatctgtggatcccgactttgatccagagccctctgatcccctg
ggttcccctagctccagccctccttatagcttaatagggtgtcgcctggcctgtgagtca
cgctatgtggctcggaagtgcggatgtcgaatgatgcatatgcctggaaactccccagtg
tgcagcccccagcagtacaaggactgtgccagcccagctctggacgctatgctgcgaaag
gacacttgtgtctgtcccaacccgtgcgccactacacgctatgccaaggagctctccatg
gtgcggattcccagccgcgcttcagctcgctacctggcccggaaatacaaccgtagcgag
acttacatcacggagaatgtactggttctggatatcttctttgaagccctcaactatgag
gccgtggaacaaaaggcagcttatgaagtgtcggagttgctgggagacattgggggacag
atgggactgtttatcggagccagcctgcttaccatcctcgagatcctcgactacctctgt
gaggtttttcaagacagagtcctggggtacttctggaacagaaggagctctcaaaggcgc
tctggcaacactctgctccaggaagagttgaatgggcatcgaacacatgttccccatctc
agcctaggccccaggcctcctaccgctcccagtgctgtcaccaagacactcgctgcctcc
caccgtacctgttacctcgtgacaaggctctag

DBGET integrated database retrieval system