KEGG   Mus musculus (mouse): 171210Help
Entry
171210            CDS       T01002                                 

Gene name
Acot2, AA571646, MTE-I, Mte1
Definition
(RefSeq) acyl-CoA thioesterase 2
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    171210 (Acot2)
   01040 Biosynthesis of unsaturated fatty acids
    171210 (Acot2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    171210 (Acot2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    171210 (Acot2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     171210 (Acot2)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   171210 (Acot2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH Peptidase_S9 FSH1 AXE1
Motif
Other DBs
NCBI-GeneID: 171210
NCBI-ProteinID: NP_598949
MGI: 2159605
Ensembl: ENSMUSG00000021226
Vega: OTTMUSG00000027592
UniProt: Q9QYR9 Q6P2K2
Position
12; 12 D1
AA seq 453 aa AA seqDB search
MVASSFAVLRASRLCQQDWKSWARLFVPPPLSTGGRTTWARTNATLSVEPEGRSCWDEPL
SIAVRGLAPEQPVTLRSALRDEKGALFRAHARYRADAGGELNLARAPALGGSFSGLEPMG
LLWAMEPERPLWRLIKRDVQTPFLVELEVLDGHEPDGGQRLAQAVHERHFLAPGVRRVPV
REGRVRATLFLPPEPGPFPGIIDLFGVGGGLLEYRASLLAGKGFAVMALAYYNYDDLPKS
IETMHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVA
AVGNTISYKDETIPPVSLLRNQVKMTKDGLLDVVEALQSPLVDKKSFIPVERSDTTFLFL
VGQDDHNWKSEFYADEISKRLQAHGKEKPQIICYPAAGHYIEPPYFPLCSAGMHLLVGAN
ITFGGEPRAHAVAQVDAWQQLQTFFHKQLGSKS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctcgtctttcgctgtcctgagagcaagcaggttgtgccaacaggattggaag
agctgggcgcggctgtttgtacctccgccgctcagcactggtggccggaccacttgggcg
cggacaaatgcgacgctgagcgtagagcccgagggccgcagctgctgggacgagccgctg
agcatcgccgtgcgcggcctggcccccgagcagcccgtcacgctgcgctctgccttgcgc
gacgagaagggcgcgctcttccgagcccacgcgcgctaccgcgccgacgctggcggcgag
ctgaacctggcgcgcgcgcccgcgctgggcggcagcttctcggggctcgagcccatgggg
ctgctctgggccatggagcccgaacggcctctctggcgcctgatcaagcgcgacgtgcag
acgcccttcttggtggagctggaggtgctggacggacacgagcccgatggcgggcagcgg
ctggcgcaggcggtgcacgagcgtcacttcttggctcccggggtgcggcgcgtgcccgta
cgagagggccgggtgcgcgccacgctcttcctgcccccagaacctggaccctttcctggg
atcatagacctttttggagttggaggtggccttctggagtatcgggcgagcctgctggct
gggaagggctttgccgtgatggctctggcttattacaactacgacgacctccccaagagc
atagaaaccatgcacatggagtactttgaagaagccgtgaactacctgcgcagccacccc
gaggtaaaaggacctggaattgggctgcttgggatttccaaagggggtgaacttggcctt
gctatggcctccttcctgaagggcatcacagctgctgtggtcatcaatggctccgtggct
gctgttgggaacaccatctcctacaaggatgagactataccccctgtgtcccttctgaga
aaccaagtcaaaatgaccaaagatggtctcttggatgtcgtggaagctctgcaaagccct
ctggtagacaagaagagcttcattcccgtggaaaggtctgacacgaccttcctgttcctc
gtaggtcaggacgaccacaactggaagagcgagttctatgctgatgagatctccaaacgc
ctgcaggcgcacgggaaggagaagccccagatcatctgctacccagcagcagggcattac
atcgagcccccttacttcccgctgtgcagcgctggcatgcacctcctggtgggtgccaac
atcacctttggaggggagcccagggctcatgccgtggcccaggtggacgcatggcagcag
ctccagactttcttccacaaacagttgggtagcaagagttag

DBGET integrated database retrieval system