KEGG   Mus musculus (house mouse): 171224
Entry
171224            CDS       T01002                                 
Symbol
Vmn1r229, V1re1
Name
(RefSeq) vomeronasal 1 receptor 229
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    171224 (Vmn1r229)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    171224 (Vmn1r229)
SSDB
Motif
Pfam: V1R TAS2R 7tm_1 DUF1218
Other DBs
NCBI-GeneID: 171224
NCBI-ProteinID: NP_598951
MGI: 2159615
Ensembl: ENSMUSG00000117148
UniProt: Q8R2A9
Position
17:21034757..21035677
AA seq 306 aa
MDFGNLAMGIVLSLQSALGILGNFSLLFYYLVLYNKERTLKIIDIILIHVFTSNSLIIFS
KGLPEVLAVFGWNDLFDDVGCKLIMYVRRVSRSMSISMTCLLSVFQAITISTRNSCWKEF
KEQTAKFMGLFISLCWILFMLVNMLFPVYTSTNRNSKNKTQKKDIEFCHSVGRDKMVDIM
YTAFCVFPEVLFSLLIVSSSTTMIVILYGHKKRVQHILHTHASPRTSAENRATQTILILV
CTFLAFYTLSSVLQGYVALSHDPSWWVMNITTIISMGFPAIGPFVMSRDFTVSRFCFTCI
GNLKLP
NT seq 921 nt   +upstreamnt  +downstreamnt
atggattttgggaacctggcaatgggaattgtactctcacttcagagtgcacttggtatt
ctgggaaacttctctcttcttttctactatttagtcctttataacaaagaacgcacatta
aagatcatagatataatacttatacatgtattcacatcaaactccttgattattttctcc
aaaggacttccagaggtacttgcagtttttggatggaatgacttattcgatgatgttggg
tgtaaactaattatgtatgttagaagagtttccaggagtatgtcaattagcatgacctgt
ctcttgagtgtctttcaggcaatcaccataagcaccaggaactcctgctggaaggaattt
aaagagcaaacagcaaagttcatgggcctgttcatttctctctgctggatcctattcatg
ctagtaaatatgcttttccctgtatatacatcaaccaacagaaatagcaaaaataaaaca
caaaaaaaagatattgaattctgccactctgtaggccgtgacaaaatggtagatataatg
tatacagcattttgtgtgtttcctgaagtcctgttttctttgctcattgtatcttccagc
accaccatgatagtcatactttatggacacaaaaagagggttcaacacatcctccacact
catgcttcccctaggacctctgctgaaaacagagccacacagaccattctgatcctggtt
tgcacctttctagcattttatacactctcttcagttttgcaaggctatgttgcactttca
catgatcccagttggtgggtaatgaatatcacgaccatcatttctatgggttttcctgct
ataggcccatttgtgatgagtcgtgatttcactgtttccagattctgctttacctgtata
ggaaatctaaaacttccataa

DBGET integrated database retrieval system