KEGG   Mus musculus (mouse): 171225
Entry
171225            CDS       T01002                                 

Gene name
Vmn1r226, V1re2
Definition
(RefSeq) vomeronasal 1 receptor 226
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    171225 (Vmn1r226)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    171225 (Vmn1r226)
SSDB
Motif
Pfam: V1R TAS2R 7tm_1 DUF1218 PIRT
Other DBs
NCBI-GeneID: 171225
NCBI-ProteinID: NP_598952
MGI: 2159616
Ensembl: ENSMUSG00000042848
Vega: OTTMUSG00000039786
UniProt: Q8R2A8
Position
17; 17 A3.2
AA seq 298 aa
MDLRTMIVGIVLSLQTALGILGNVSLLFYYLIIYYNEHTMKKIDMILIHVFTSNFLTILS
KGLPEVVKAFGWKQLFSDVGCKLTNYFQRLARSMSISTTCFLSVFQAITISPRNSCLKEY
KTKTTKFMGLFFSLCWILFILVNMLFPIYTATNRNKKNKTQKRDFEFCHSIGRDKLVDIM
YTAFCVFPEVIFSLLIVSSSAFMIFILYGHKKRVQHTLHIHASIRNSAENRATHNILTLV
CTFLAFYTLSSILQGYIALSNNPSWWVMNITAIISMCFPTLGPIVISPDFAISRFCFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atggacttgaggaccatgatagttggaatagtgctctcacttcagacggcacttggtatt
ctaggaaacgtctctcttcttttctactacctaatcatttattacaatgaacacacaatg
aagaaaatagatatgattcttatacatgtgttcacatccaacttcttaactattctttcc
aaaggactccctgaagtagtgaaagcttttgggtggaagcagttattcagtgatgttggg
tgcaaacttactaattattttcaaagactagccaggagtatgtccatcagcaccacctgt
ttcttgagtgtctttcaagcaatcaccattagccccaggaactcctgcttgaaggaatat
aaaaccaaaactacaaagtttatgggcctgttcttttctctctgctggatccttttcatt
ctagtaaatatgcttttccccatttatacagctaccaataggaataaaaaaaataagaca
caaaagagagactttgaattctgccactctataggtcgtgacaaactagtagatataatg
tatacagcattttgtgtatttcctgaagtcatattttctctgctcattgtaagttccagt
gcttttatgattttcatactttatggacataagaagagggttcaacacactctccacatt
catgcctccatcagaaactctgctgaaaacagagccacacacaacatcttgactctggtt
tgtacatttctagcattttatactctctcttcaattttacaaggctatattgctctttca
aataatcccagttggtgggtaatgaatatcacagcaataatttccatgtgttttcctaca
ttaggccctattgtgataagtcctgatttcgctatttccagattctgctttacctag

DBGET integrated database retrieval system