KEGG   Mus musculus (mouse): 17123
Entry
17123             CDS       T01002                                 

Symbol
Madcam1, AV211525, MAdCAM-1
Name
(RefSeq) mucosal vascular addressin cell adhesion molecule 1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    17123 (Madcam1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    17123 (Madcam1)
SSDB
Motif
Pfam: Adhes-Ig_like ICAM_N Ig_2 Ig_3
Other DBs
NCBI-GeneID: 17123
NCBI-ProteinID: NP_001345714
MGI: 103579
Ensembl: ENSMUSG00000020310
Position
10 C1; 10 39.72 cM
AA seq 261 aa
MESILALLLALALVPYQLSRGQSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRG
LDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVYAFPDQLVVSPE
FLVPGQDQVVSCTAHNIWPADPNSLSFALLLGEQRLEGAQALEPEQEEEIQEAEGTPLFR
MTQRWRLPSLGTPAPPALHCQVTMQLPKLVLTHRKEIPASTVVLWIGSLVLGLLALVFLA
YRLWKCYRPGPRPDTSSCTHL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggaatccatcctggccctcctgctggccctggccctagtaccctaccagctcagcaga
ggacagtccttccaggtgaacccccctgagtctgaggtagctgtggccatgggcacatcc
ctccagatcacctgcagcatgtcctgtgacgagggtgtagcccgggtgcactggcgtggt
ctggacaccagcttgggcagtgtacagaccctcccaggcagcagtatcctctctgtacgg
ggcatgctgtcagacacaggcactcctgtgtgtgtgggctcctgcgggagtcgaagcttc
cagcactccgtgaagatccttgtgtatgccttcccagaccagctggtggtgtccccggag
ttccttgtacctggacaggaccaggtggtgtcctgcacggcccacaacatctggcctgca
gacccgaacagtctctcctttgccctgctactgggagagcagagactggagggtgcccaa
gccctggaaccagagcaagaagaggagatacaagaggctgagggcacaccactgttccga
atgacacaacgctggcggttaccctccctggggacccctgcccctcctgcccttcactgc
caggtcaccatgcagctgcccaaactggtgctgacccatagaaaggagattccagcctcc
accgtcgtcctatggattggcagcttggtgctggggctgcttgcactggtcttccttgcc
taccgcctgtggaaatgctaccggccaggtcctcgcccagacactagctcatgtacacac
ctatga

DBGET integrated database retrieval system