KEGG   Mus musculus (house mouse): 171241
Entry
171241            CDS       T01002                                 
Symbol
Vmn1r75, V1rg6
Name
(RefSeq) vomeronasal 1 receptor 75
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    171241 (Vmn1r75)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    171241 (Vmn1r75)
SSDB
Motif
Pfam: V1R TAS2R
Other DBs
NCBI-GeneID: 171241
NCBI-ProteinID: NP_598968
MGI: 2159645
Ensembl: ENSMUSG00000043308
Position
7:11614270..11615187
AA seq 305 aa
MRMATRHFAMGIFLFSQITLGILGNSSILFHYIFLILTGKHLMPKDLILKHLTFANCLSI
ISRGIPRAMSDCGLKDFLDDIACKLIVYICRITRGMSLYAMCLLSCFQAITINPSNCRCL
TLKHRATKYIGHCCSVSWLLHLFLNILTPARVSGPSYKKNVTNMSYGYCSWVASGNVATA
LYMLLLCFSDALCLTLMACSSVSMVSVLYRHKRQVKHIHSAQHALKDSPEDRATQTILIL
MCIFVLSYSFSSIVVILTTYSKYPMLWGVSVLTFIEICFPIFCPFVIISNMNSSSSPFLP
CFGKR
NT seq 918 nt   +upstreamnt  +downstreamnt
atgagaatggctaccaggcattttgcaatgggaatttttctcttctcccagattacattg
ggaatacttggcaattcctcaatactatttcattacatctttttgatactcactggaaaa
cacttaatgcccaaagatctgattttaaagcacttgacttttgccaattgcctgtctatc
atctcaagaggcattccacgggcaatgtcagattgtggacttaaggattttcttgatgat
attgcatgtaaattgatagtgtatatatgccgaataacaagggggatgtccctttatgca
atgtgtctactcagttgtttccaagcaatcactatcaaccctagcaactgcaggtgtttg
acactcaagcacagagccaccaagtacattggtcattgctgctcagtcagttggcttctg
cacctgtttctaaacatcttgactccagcaagagtgtcaggccccagttacaagaaaaat
gtgactaacatgagttatgggtactgctcatgggttgcttcaggcaatgtggcaactgca
ctatatatgttattactgtgcttctctgatgctctgtgtctgactctcatggcctgctca
agtgtctctatggtgagtgtcctctacagacataaaagacaagtcaaacatatccacagt
gctcagcatgctctaaaagactctcctgaagacagagccacacaaactatcctcatcctg
atgtgcatatttgtcctctcttactcattctcctccatagtggtcatcttgacaacctac
tccaaatatccaatgctatggggggtaagtgtacttacatttatagaaatatgctttccc
atattttgtccctttgttatcattagcaacatgaactctagttccagcccatttttaccc
tgctttggtaagcggtaa

DBGET integrated database retrieval system