KEGG   Mus musculus (house mouse): 17125
Entry
17125             CDS       T01002                                 
Symbol
Smad1, AI528653, Mad1, Madh1, Madr1, Mlp1, MusMLP, dwf-A, mMad1
Name
(RefSeq) SMAD family member 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17125 (Smad1)
   04390 Hippo signaling pathway
    17125 (Smad1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17125 (Smad1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17125 (Smad1)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 17125
NCBI-ProteinID: NP_032565
MGI: 109452
Ensembl: ENSMUSG00000031681
UniProt: P70340
Structure
Position
8:complement(80065024..80126057)
AA seq 465 aa
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ
PMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaatgtgaccagcttgttttcattcacaagtccagctgtgaagagactccttgggtgg
aaacagggcgatgaagaagagaaatgggcagagaaagctgtggacgctttggtgaagaaa
ctgaagaagaagaaaggggccatggaagagctggagaaggccctgagctgccctggacag
ccgagtaactgcgtcaccattcctcgctccctggatggcaggttgcaggtgtcccaccgg
aagggactacctcatgtcatttattgccgtgtgtggcgctggcccgacctccagagccac
catgaactgaagcctctggaatgctgtgagttcccatttggttccaagcagaaggaggtc
tgcatcaacccctaccactataagcgagtggagagcccggttctcccgccggtgctggtt
ccgaggcacagcgagtacaatcctcagcacagccttctggctcagttccgcaacctggga
caaaatgagcctcacatgccactgaacgccacgttcccagactctttccagcagcccaac
agccacccgttcccccactcccccaacagcagctaccccaactctcctggcggcagcagc
agcacctaccctcactccccaaccagctcagacccgggcagcccttttcagatgccagct
gacacacccccacctgcttacctgcctcctgaagaccccatggcccaggatggctctcag
cccatggacacgaacatgatggcgcctccactgcccgctgaaatcagcagaggagatgtt
caggcagttgcttacgaggaaccaaaacactggtgctctattgtgtactatgagctcaac
aaccgtgtgggtgaagcgttccacgcctcgtccaccagcgtgctggtggatggtttcaca
gatccgtccaacaataagaaccgcttctgccttggcttgctctccaacgttaaccggaat
tccactattgaaaacaccaggcgacatattgggaaaggagtccacctttattacgttgga
ggagaggtgtatgcggaatgcctcagtgacagcagcatcttcgtgcagagccggaactgc
aactaccaccacggctttcaccccaccaccgtctgcaagatccccagcgggtgcagcttg
aaaatcttcaacaaccaagagtttgctcagctactggcgcagtctgtgaaccacgggttc
gagaccgtgtatgaactcaccaaaatgtgcactattcggatgagcttcgtgaagggttgg
ggagccgaataccaccggcaggatgttaccagcaccccctgctggattgagatccatctg
catggccctctccagtggctggataaggttctgacccagatgggctcaccccacaatcct
atttcatccgtgtcttaa

DBGET integrated database retrieval system