KEGG   Mus musculus (house mouse): 171283
Entry
171283            CDS       T01002                                 
Symbol
Havcr1, AI503787, KIM-1, TIM-1, Tim1, Timd1
Name
(RefSeq) hepatitis A virus cellular receptor 1
  KO
K20413  hepatitis A virus cellular receptor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03264  Virion - Flavivirus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03264 Virion - Flavivirus
    171283 (Havcr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    171283 (Havcr1)
CD molecules [BR:mmu04090]
 Proteins
  171283 (Havcr1)
SSDB
Motif
Pfam: V-set I-set Ig_2 Receptor_2B4
Other DBs
NCBI-GeneID: 171283
NCBI-ProteinID: NP_599009
MGI: 2159680
Ensembl: ENSMUSG00000040405
UniProt: Q5QNS5 A0A0A0MQ86
Structure
Position
11:46630644..46670405
AA seq 305 aa
MNQIQVFISGLILLLPGAVDSYVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSAC
QNTLIWTNGHRVTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQK
VTFSLQVKPEIPTRPPRRPTTTRPTATGRPTTISTRSTHVPTSTRVSTSTPPTSTHTWTH
KPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNHTEAIPPGKPQKNPTKGFYV
GICIAALLLLLLVSTVAITRYILMKRKSASLSVVAFRVSKIEALQNAAVVHSRAEDNIYI
VEDRP
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaatcagattcaagtcttcatttcaggcctcatactgcttctcccaggcgctgtggat
tcttatgtggaagtaaagggggtggtgggtcaccctgtcacacttccatgtacttactca
acatatcgtggaatcacaacgacatgttggggccgagggcaatgcccatcttctgcttgt
caaaatacacttatttggaccaatggacatcgtgtcacctatcagaagagcagtcggtac
aacttaaaggggcatatttcagaaggagatgtgtccttgacgatagagaactctgttgag
agtgacagtggtctgtattgttgtcgagtggagattcctggatggtttaatgatcagaaa
gtgaccttttcattgcaagttaaaccagagattcccacacgtcctccaagaagacccaca
actacaaggcccacagctacaggaagacccacgactatttcaacaagatccacacatgta
ccaacatcaaccagagtctctacctccactcctccaacatctacacacacatggactcac
aaaccagaacccactacattttgtccccatgagacaacagctgaggtgacaggaatccca
tcccatactcctacagactggaatggcactgtgacatcctcaggagatacctggagtaat
cacactgaagcaatccctccagggaagccgcagaaaaaccctactaagggcttctatgtt
ggcatctgcatcgcagccctgctgctactgctccttgtgagcaccgtggctatcaccagg
tacatacttatgaaaaggaagtcagcatctctaagcgtggttgccttccgtgtctctaag
attgaagctttgcagaacgcagcggttgtgcattcccgagctgaagacaacatctacatt
gttgaagatagaccttga

DBGET integrated database retrieval system