KEGG   Mus musculus (house mouse): 171284
Entry
171284            CDS       T01002                                 
Symbol
Timd2, AA816106, AU019358, AU019662, C78111, G9D3, TIM-2, Tim2
Name
(RefSeq) T cell immunoglobulin and mucin domain containing 2
  KO
K20413  hepatitis A virus cellular receptor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03264  Virion - Flavivirus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03264 Virion - Flavivirus
    171284 (Timd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    171284 (Timd2)
CD molecules [BR:mmu04090]
 Proteins
  171284 (Timd2)
SSDB
Motif
Pfam: V-set ig I-set DUF3292 Ig_3
Other DBs
NCBI-GeneID: 171284
NCBI-ProteinID: NP_001154827
MGI: 2159681
Ensembl: ENSMUSG00000040413
UniProt: Q8R183 A8C1R4
Structure
Position
11:complement(46559787..46597934)
AA seq 305 aa
MNQIQVFISGLILLLPGAVESHTAVQGLAGHPVTLPCIYSTHLGGIVPMCWGLGECRHSY
CIRSLIWTNGYTVTHQRNSRYQLKGNISEGNVSLTIENTVVGDGGPYCCVVEIPGAFHFV
DYMLEVKPEISTSPPTRPTATGRPTTISTRSTHVPTSTRVSTSTSPTPAHTETYKPEATT
FYPDQTTAEVTETLPSTPADWHNTVTSSDDPWDDNTEVIPPQKPQKNLNKGFYVGISIAA
LLILMLLSTMVITRYVVMKRKSESLSFVAFPISKIGASPKKVVERTRCEDQVYIIEDTPY
PEEES
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaatcagattcaagtcttcatttcaggcctcatactgcttctcccaggtgccgtggag
tctcatacagcagtgcaggggctggcgggtcaccctgtcacacttccatgtatttattcg
acacaccttggtggaatcgttcctatgtgttggggcctaggggaatgccgccattcttat
tgtatacggtcacttatctggaccaatggatatacggtcacacatcagaggaacagtcga
taccagctaaaggggaatatttcagaaggaaatgtgtccttgaccatagagaacactgtt
gtgggtgatggtggtccctattgctgtgtagtggagatacctggagcgttccattttgtg
gactatatgttggaagttaaaccagaaatttccacgagtccaccaacaaggcccacagct
acaggaagacccacaactatttcaacaagatccacacatgtaccaacatcaaccagagtc
tctacctctacttctccaacaccagcacacacagagacctacaaaccagaggccactaca
ttttatccagatcagactacagctgaggtgacagaaaccttaccctctactcctgcagac
tggcataacactgtgacatcctcagatgacccttgggatgataacactgaagtaatccct
ccacagaagccacagaaaaacctgaataagggcttctatgttggcatctccattgcagcc
ctgctgatattgatgcttctgagcaccatggttatcaccaggtacgtggttatgaaaagg
aagtcagaatctctgagcttcgttgccttccctatctctaagattggagcttcccccaaa
aaagtggtcgaacggaccagatgtgaagaccaggtctacattattgaagacactccttac
cccgaagaagagtcctag

DBGET integrated database retrieval system