KEGG   Mus musculus (mouse): 17129Help
Entry
17129             CDS       T01002                                 

Gene name
Smad5, 1110051M15Rik, AI451355, Dwf-C, Madh5, MusMLP
Definition
(RefSeq) SMAD family member 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17129 (Smad5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17129 (Smad5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 17129
NCBI-ProteinID: NP_001157513
MGI: 1328787
Ensembl: ENSMUSG00000021540
Vega: OTTMUSG00000020956
UniProt: P97454
Structure
PDB: 

Position
13 B1; 13 30.12 cM
AA seq 465 aa AA seqDB search
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQP
MDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggccagcttgttttctttcactagtccagccgtgaagcgattgttgggc
tggaaacaaggtgacgaggaagagaaatgggcagaaaaggcagtggatgctttagtgaaa
aagctgaagaagaagaagggtgctatggaggagctggagaaagccttgagcagcccagga
cagccaagcaagtgtgtcacgatccccaggtccttggatggacgtctgcaagtttctcac
aggaaaggcttgccccatgttatatattgccgtgtttggcgctggccagatttgcagagc
catcacgagctaaaaccattggatatttgtgaatttccttttggatctaagcaaaaggaa
gtttgtatcaatccataccactataagagagtggagagtccagtcttacctccagtatta
gtgcctcgtcacaatgaattcaatccacaacacagccttctggttcagttcaggaacctg
agccacaatgaaccgcacatgccacaaaacgccacgtttcccgattctttccaccaaccc
aacaacgctcctttccccttatctcctaacagcccctatcctccttcccctgctagcagc
acatatcccaactccccagcaagctctggacctggaagtccatttcaactcccagctgac
acccctccccctgcctatatgccacctgatgatcagatggccccagataattcccagcct
atggatacaagcagtaacatgattcctcagaccatgcccagcatatccagcagagatgtt
cagcctgtcgcctatgaggagcccaaacactggtgttcgattgtctactatgaattaaac
aatcgtgttggggaagcttttcatgcatcttctactagtgtgttagtagatggatttaca
gatccttcaaataacaaaagtagattctgcctgggattgttgtcaaatgttaatcgtaat
tcaactattgaaaacactaggcggcatattggaaaaggtgttcatctatactacgttggt
ggggaggtgtacgctgagtgtcttagtgacagcagcatctttgttcagagtaggaactgc
aactttcaccatggcttccatcccaccaccgtctgtaagatccccagcagctgcagcctc
aagatttttaacaatcaggagtttgctcagcttctggctcagtcagtcaaccatggattc
gaggctgtgtatgagctcaccaagatgtgtaccattcgaatgagctttgtcaagggctgg
ggagcagagtaccaccgacaggacgtcaccagtactccctgctggattgagattcacctc
cacgggcctctgcagtggctggataaagtccttactcagatgggctctccgctgaacccc
atttcttctgtttcatag

DBGET integrated database retrieval system