KEGG   Mus musculus (mouse): 17131Help
Entry
17131             CDS       T01002                                 

Gene name
Smad7, Madh7
Definition
(RefSeq) SMAD family member 7
  KO
K19631  mothers against decapentaplegic homolog 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17131 (Smad7)
   04390 Hippo signaling pathway
    17131 (Smad7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1
Motif
Other DBs
NCBI-GeneID: 17131
NCBI-ProteinID: NP_001036125
MGI: 1100518
Ensembl: ENSMUSG00000025880
Vega: OTTMUSG00000024306
UniProt: O35253 B2RPW6
Position
18; 18 E3
AA seq 426 aa AA seqDB search
MFRTKRSALVRRLWRSRAPGGEDEEEGVGGGGGGGELRGEGATDGRAYGAGGGGAGRAGC
CLGKAVRGAKGHHHPHPPTSGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPASAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTAGCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgtggggggtggcggcggaggaggcgagctgcggggagaa
ggggcgacggacggccgggcttatggggctggtggcggcggtgcgggcagggctggctgc
tgcctgggcaaggcagtccgaggtgccaaaggtcaccaccatccccatcccccaacctcg
ggtgccggggcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactcaaggagcggcagctggagctgctgcttcaggccgtggagtcccgcggcggt
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccagcgcgcagcccgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagtcga
ctctgtgaactagagtctccccctcctccttactccagatacccaatggattttctcaaa
ccaactgcaggctgtccagatgctgtaccttcctccgcggaaaccgggggaacgaattat
ctggcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacac
tggtgcgtggtggcatactgggaggagaagactcgcgtggggaggctctactgtgtccaa
gagccctccctggatatcttctatgatctacctcaggggaatggcttttgcctcggacag
ctcaattcggacaacaagagtcagctggtacagaaagtgcggagcaagatcggctgtggc
atccagctgacgcgggaagtggatggcgtgtgggtttacaaccgcagcagttaccccatc
ttcatcaagtccgccacactggacaacccggactccaggacgctgttggtgcacaaagtg
ttccctggtttctccatcaaggcttttgactatgagaaagcctacagcctgcagcggccc
aatgaccacgagttcatgcagcaaccatggacgggtttcaccgtgcagatcagctttgtg
aagggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctggag
gtcatcttcaacagccggtag

DBGET integrated database retrieval system