KEGG   Mus musculus (mouse): 17132
Entry
17132             CDS       T01002                                 

Gene name
Maf, 2810401A20Rik, A230108G15Rik, AW047063, c-ma, c-maf
Definition
(RefSeq) avian musculoaponeurotic fibrosarcoma oncogene homolog
  KO
K09035  transcription factor Maf
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05202  Transcriptional misregulation in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    17132 (Maf)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17132 (Maf)
  09163 Immune disease
   05321 Inflammatory bowel disease
    17132 (Maf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17132 (Maf)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    17132 (Maf)
SSDB
Motif
Pfam: bZIP_Maf Maf_N ZapB bZIP_1 bZIP_2 KASH_CCD GAS vATP-synt_E
Other DBs
NCBI-GeneID: 17132
NCBI-ProteinID: NP_001020748
MGI: 96909
Ensembl: ENSMUSG00000055435
Vega: OTTMUSG00000024922
UniProt: P54843
Position
8 E1; 8 62.61 cM
AA seq 370 aa
MASELAMNNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAAPH
YHHHHHHAAGHHHHPTAGAPGAAGGASASASGAGGAGGGGPASAGGGGGGGGGGGTAGAG
GALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQ
SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSNGFRENGSSS
DNPSSPEFFM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcttcagaactggcaatgaacaattccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccctgcagctcggtgcccccgtcccccagcttctcggcgcccagcccgggctcg
ggcagcgaacagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctcaacccggaggcgctgggcttcagcccggaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggtggcttcgatggctatgcgcggggagcgcagcagctggccgcg
gcagcgggggccggcgccggcgcctccctgggcggcagcggcgaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgccgcgcagagcggcgcggcaccccac
taccatcaccaccaccaccacgccgcggggcaccaccaccatccgacggccggcgccccg
ggagccgcgggcggcgcgtctgcctctgcgagcggcgcgggtggcgcgggcggcggtggc
ccggccagcgccgggggcggcggcggcggaggcggcggcgggggcacggcgggggcgggg
ggcgccctgcacccgcaccatgccgcgggcggcctgcacttcgacgaccgcttctcggac
gagcagttggtgaccatgtcggtgcgcgagctgaaccggcagctgcgcggggtcagcaag
gaggaggtgatccgactgaagcagaagaggcggaccctgaaaaaccgcggctatgcccag
tcctgccgcttcaagagggtgcagcagagacacgtcctggagtcggagaagaaccagctg
ctgcagcaggtagaccacctcaagcaggagatctccaggctggtgcgcgaaagggacgcc
tacaaggagaaatacgagaagctggtgagcaacggcttccgagaaaacggctcgagcagc
gacaacccttcctctcccgaatttttcatgtga

DBGET integrated database retrieval system