KEGG   Mus musculus (mouse): 17135
Entry
17135             CDS       T01002                                 

Symbol
Mafk, AW061068, NF-E, NF-E2, Nfe2, Nfe2u
Name
(RefSeq) v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)
  KO
K09037  transcription factor MAFF/G/K
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17135 (Mafk)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    17135 (Mafk)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 DivIC CALCOCO1 Cnn_1N DUF1192 Spc24 PilJ FapA Prominin bZIP_2 UPF0242 YabA DASH_Spc19 GIT_CC Spc7 DUF4164
Other DBs
NCBI-GeneID: 17135
NCBI-ProteinID: NP_034887
MGI: 99951
Ensembl: ENSMUSG00000018143
Vega: OTTMUSG00000025256
UniProt: Q61827 Q3UP84
Position
5 G2; 5 78.81 cM
AA seq 156 aa
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK
NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART
VARGPVTPTKVATTSVITIVKSAELSSTSVPFSAAS
NT seq 471 nt   +upstreamnt  +downstreamnt
atgacgactaatcccaagcccaacaaggcattgaaggtcaagaaggaggcgggtgagaac
gcccctgttcttagcgatgatgagctggtgtccatgtcagtgcgggagctaaaccagcac
ctgcgggggctcaccaaggaggaggtcactcggctgaagcagcggcggcgcacactcaag
aacagaggctacgcggctagctgtcgcatcaagcgtgtgacacagaaagaggagctggaa
cggcagcgtgtggagctacagcaggaggtggagaagctggctcgagagaacagcagcatg
cggctggagctagatgccctgcgctccaagtatgaggccctacagaccttcgctcgcacc
gtggcccgagggcctgtcacacccaccaaggtggccaccaccagtgtcatcaccatcgtc
aaatctgccgagctctcctccacctctgtacccttctcagccgcctcctag

DBGET integrated database retrieval system