KEGG   Mus musculus (house mouse): 171388
Entry
171388            CDS       T01002                                 
Symbol
Bnipl, 1700128A13Rik, BNIP-S, BNIPL1, BNIPL2, PP73, PP753
Name
(RefSeq) BCL2/adenovirus E1B 19kD interacting protein like
  KO
K18448  BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    171388 (Bnipl)
SSDB
Motif
Pfam: BNIP2 CRAL_TRIO_2 CRAL_TRIO
Other DBs
NCBI-GeneID: 171388
NCBI-ProteinID: NP_001161828
MGI: 2384749
Ensembl: ENSMUSG00000028115
Position
3:complement(95148587..95158504)
AA seq 280 aa
MGTRQETGRETLEGGLLPEEPGSPGDPEDPQRGSQAGTPSSLALCGQRPMRKRLSAPEWQ
LSLTEGTGENGASPTRSASSSSAGSLDLEVDELETPSDSEQLDSGHEFEWEDDLPRAEGL
GASEAAERLGRGCVCDVAGEDGHRWRVFRTGQREQRVDMTIIEPYKKVLSHGGYHGDGLN
AVILFASCYLPRSSIPNYTYIMEHLFRLRKNLRALVVVHATWYVKAFLALVRPFISSKFT
RKIRFLDSLGELAQLISLEQVHIPEVVRQLDRDLHGSKGT
NT seq 843 nt   +upstreamnt  +downstreamnt
atggggaccaggcaagaaacaggaagagagacgttagaaggaggattgcttcctgaggaa
cctggctcacctggagaccctgaagaccctcagagaggctcacaggcaggcacccccagc
agtctggccttgtgtggccagcgccctatgcggaagcgtctttccgccccagaatggcag
ctgagtctgactgagggaacaggagaaaacggagcctctcccacccgctctgcgtcttcc
tcttctgctggcagcttggacctggaggtggatgagttggagacaccatcagactctgag
cagctggacagcggacatgagtttgaatgggaagatgacttgccccgggcagagggcctg
ggggccagtgaggcagcagaaagactgggccggggatgcgtgtgcgatgtggctggagaa
gacggtcatcgctggagagtgtttcgaacaggacaacgagagcagcgagtggacatgacc
atcattgagccctataagaaagtcttatctcatggaggttaccatggtgatggcctcaat
gctgtcatcctctttgcttcctgctatctaccccgaagcagcatccccaactacacctac
atcatggaacacttattcaggcttcggaaaaaccttcgcgccctggtggtcgtccacgct
acgtggtatgtgaaggccttcctggcactggttcggcccttcatcagctccaagttcaca
cgaaagatccgctttctggacagcctcggagagctggcccagctcatctcgctagagcaa
gtgcacataccggaagttgtcagacagctggaccgggatctgcatggctcgaaaggcacc
taa

DBGET integrated database retrieval system