KEGG   Mus musculus (mouse): 17147Help
Entry
17147             CDS       T01002                                 

Gene name
Mageb3, Mage-b3, Mage-ps1, Mage-rs3, Smage3
Definition
(RefSeq) melanoma antigen, family B, 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE MAGE_N
Motif
Other DBs
NCBI-GeneID: 17147
NCBI-ProteinID: NP_032571
MGI: 105109
Ensembl: ENSMUSG00000074881
Vega: OTTMUSG00000015439
UniProt: Q9D2H4
Position
2; 2 E5
AA seq 330 aa AA seqDB search
MPRGQKSKSRSRAKRQQSRREVQVVQPTAEEAGSSPVDLSAGSSFPGGSAPQGVKNPGSF
GAGVSCTGSGIGGRNATVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLIEFLLDKFKMK
EAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYLLVGKLGLSTE
GSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGKKHLIFGEPEEFIR
DVVQENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLKVLAKVNGTVPSAFPNLYQLA
LRDQAGGVPRSRVQGKGVHSKAPSQKSSNV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggggtcaaaagagtaagagccgctcccgtgctaaacgacagcagtcacgcagg
gaggttcaagtagttcagcccactgcagaggaagcagggtcttctcctgttgacctgagt
gctgggtccagcttccctggtggttctgctcctcagggtgtgaaaaaccctggatctttt
ggtgcaggtgtatcctgcacaggctctggtataggtggtagaaatgctactgtcctgcct
gatacaaaaagttcagatggcacccaggcagggacttccattcagcacacactgaaagat
cctatcatgaggaaggctagtgtgctgatagaattcctgctagataaatttaagatgaaa
gaagcagttacaagaagtgaaatgctggcagtagttaacaagaagtataaggagcaattc
cctgagatcctcaggagaacttctgcacgcctagaattggtctttggtcttgagttgaag
gaaattgatcccagcactcattcctatttgctggtgggcaaactgggtctttccactgag
ggaagtttgagtagtaactgggggttgcctaggacaggtctcctaatgtctgtcctaggt
gtgatcttcatgaagggtaaccgtgccactgagcaagaggtctggcaatttctgcatgga
gtgggggtatatgctgggaagaagcacttgatctttggcgagcctgaggagtttataaga
gatgtagtgcaggaaaattacctggagtaccgccaggtacctggcagtgatcccccaagc
tatgagttcctgtggggacccagagcccatgctgaaacaaccaagatgaaagtcctgaaa
gttttagctaaagtcaatggcacagtccctagtgccttccctaatctctaccagttggct
cttagagatcaggcaggaggggtgccaagaagtagagttcaaggcaagggtgttcattcc
aaggccccatcccaaaagtcctctaatgtgtag

DBGET integrated database retrieval system