KEGG   Mus musculus (mouse): 171486
Entry
171486            CDS       T01002                                 

Gene name
Cd99l2, AW548191, Mic2, Mic2l1, Xap89
Definition
(RefSeq) CD99 antigen-like 2
  KO
K06520  CD99 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    171486 (Cd99l2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    171486 (Cd99l2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    171486 (Cd99l2)
CD molecules [BR:mmu04090]
 Proteins
  171486 (Cd99l2)
SSDB
Motif
Pfam: CD99L2 ACT_7 Ribosomal_L23eN
Other DBs
NCBI-GeneID: 171486
NCBI-ProteinID: NP_001186278
MGI: 2177151
Ensembl: ENSMUSG00000035776
Vega: OTTMUSG00000017999
UniProt: Q8BIF0
Position
X; X A7.3
AA seq 237 aa
MVARLTAFLVCLVFSLATLVQRGYGDTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTR
APANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGG
WSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIAGVASALAMALIGAVSS
YISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVTYSKQETQSAEPPPPEPPRI
NT seq 714 nt   +upstreamnt  +downstreamnt
atggtggccaggctcacggctttcctcgtttgcctcgttttctccttggccacccttgtc
cagagaggatatggagacacagatggttttaatctggaggatgcactgaaagaaacttcc
tcagtaaagcagagatgggaccacttcagcaccacgactaggaggccagtaacaaccaga
gccccagcaaatccagcagagagatgggaccatgttgccactactacaactagaaggcca
ggaacaactagagcaccatcaaatcctatggaactagatgggtttgacttggaagatgcc
ttggatgatcgaaatgatctagatggtcccaaaaagccaagtgcaggagaagcaggaggt
tggtcagacaaggatcttgaagacatcgtggaaggtgggggatacaaacctgacaagaat
aaaggcggtggtggttatggcagcaacgatgaccctggatctggcatatcgacagaaact
ggcaccattgcaggtgtggccagtgcccttgctatggccctgattggagctgtatccagc
tacatctcctaccagcagaagaagttttgcttcagcattcagcagggcctcaatgcagac
tacgtgaagggggagaacctggaagctgttgtgtgtgaggagccccaagtgacatactca
aaacaagaaacgcagtctgcagaacccccaccacccgagccaccccggatttga

KEGG   Mus musculus (mouse): 673094
Entry
673094            CDS       T01002                                 

Gene name
Cd99, 1110061M03Rik, 2410026K10Rik, D4, Pilr-l, pi, pilr-1
Definition
(RefSeq) CD99 antigen
  KO
K06520  CD99 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    673094 (Cd99)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    673094 (Cd99)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    673094 (Cd99)
CD molecules [BR:mmu04090]
 Proteins
  673094 (Cd99)
SSDB
Motif
Pfam: CD99L2 DUF4229
Other DBs
NCBI-GeneID: 673094
NCBI-ProteinID: NP_079860
MGI: 1913728
UniProt: Q8VCN6
Position
4
AA seq 175 aa
MARAAMEAAATVVLALALLGAAARGAASDDFNLGDALEDPNMKPTPKAPTPKKPSGGFDL
EDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDE
GGHGGAGGAEPEGTPQGLVPGVVAAVVAAVAGAVSSFVAYQRRRLCFREGGSAPV
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcgcgcgcggcgatggaggcggcggcgaccgtggttttggccctggcgctgctcggg
gccgcggcgcggggcgcggcgagtgacgacttcaacctgggcgacgccctggaggacccc
aacatgaagccaacccccaaggccccaacgcccaagaagccgtcaggaggcttcgacctg
gaggacgccctgcccggcggcggcggaggaggcgcaggagagaagccgggaaaccggccc
cagccggacccgaagccgccaaggccacacggagactcaggcggcatctcggacagcgac
ctggcagacgccgcgggccagggaggaggcggagccgggcgacgcgggagcggagacgaa
ggcggccatggcggcgctggcggggcggagccggaagggacgccccagggcttggtgccg
ggcgtggtggcggccgtggtggccgccgtggcgggcgcggtgtcgagcttcgtggcctat
cagcggcggcgcctgtgcttccgcgagggcggctccgcccccgtgtag

DBGET integrated database retrieval system