KEGG   Mus musculus (mouse): 171504Help
Entry
171504            CDS       T01002                                 

Gene name
Apobr, Apob-48r, Apob48r
Definition
(RefSeq) apolipoprotein B receptor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 171504
NCBI-ProteinID: NP_612183
MGI: 2176230
Ensembl: ENSMUSG00000042759
Vega: OTTMUSG00000029445
UniProt: Q8VBT6
Position
7; 7 F3
AA seq 942 aa AA seqDB search
MDFLRLRLPGLHQALRGALDSFSAFVSYLVGDTVPTVERQTQAAEELGEVTEGKVVGEEA
QEVLEGLRSGQSEGVEAPEETRRCQEGSLAGEQTWGWRADSSARPQAERQDTGSWKAAED
ARGQEPSVPLKPEAEPGTHRDRSSNTAQEIWEHGEEEASSGEPLRTCEQKEEEEEVVRAA
ESGMAEGVESQPTWHSEPGGNAGTEGQHVTEDSKEIDWVAKDMVAEIEWFGAKGIDKEEE
RMVPMRDGERARAQGTQCPGAESEDQAMLSREAWTVSDREGADSLGVQGTEYGSDPGDNF
PGTTGRVWVLEEADKGDQQDEVDEKREAEVRFPIQTLEAERTGEMTEGHIAEEEAMGEQE
TEGSFEDEERQDLAIRDNGVSLEEEVRAEESSREKRNSWATEPTLVLDTEAKDEPDWEDS
PEVSTEELFVGERSEAAQMTPEVLRVKVTEGQDPELVRHSQALTKQLEEGQKGQEETSGA
PDLSPERVLSLKEYPGPVGFAGPELEAWGNWSRGVDRRNSQEVKADAEAGKEQTATEQAV
EIRAEGGQEAQQPEVFGSGGEEALTSVALNPELEGSQGAEAGTEESVEESKPTENEAAEE
EAVVPWEADGTCRKRRLEEVTLSLQDSEDTETSYLAEEIIVGIRAVDTEEGPKWEAGLAP
ETELGKAWCSEGRGEAGRGTELEETTEKQSGQEVGLVGSAEKVSGYDIQEIDGTEEGEQA
EMETSVMAEDIRGTDGVTLGSQAERAEGSITPMETEGLLRDQMLLEEEAGGGQSREQKVH
NSEGEIQTLDDSSDQEGQQTHQIPTVAVPGPLESAEATAGAPGDVHSNWNEALLPGSRLD
VSVPRSRVLLSRSSSRRRSRPSFHRISVPEPQCDPPSPQPQAERPVPEQSSLQLEETPEL
SATKPEGTPVPARRKMLGRGFGFAHPGMMQELQARLSQPKPQ
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggattttctccggcttcgtctccctgggctacatcaggctttgaggggagcactggac
tccttcagtgcgtttgtgtcctacctcgtaggagacacagtccccacagtagagaggcag
acacaggcagctgaggaactgggagaggtgactgaggggaaggttgtaggagaggaagcc
caggaggtactggagggacttagaagtggccagagtgagggggtagaagcacccgaagag
actagaagatgccaagaaggaagtttagctggtgaacagacctgggggtggagagcagat
agctctgcaaggccccaagcagaaaggcaggacactgggtcctggaaggcagctgaggat
gccaggggccaggagccaagtgtcccactgaagcctgaggcagagcctgggactcacaga
gacaggagcagtaatacagcccaggagatctgggagcacggtgaagaggaagcaagcagt
ggggagcctctgagaacctgtgaacagaaggaagaagaggaggaggtggtcagagcagca
gagtcagggatggccgagggggtggagtcacagccaacctggcacagcgagcctgggggg
aatgctggcactgaggggcagcatgtgacagaggacagcaaagagatagactgggtggcc
aaagacatggttgcagaaatcgaatggtttggtgccaaagggattgacaaggaagaggag
aggatggtcccaatgagggatggtgaaagggcaagggcacaggggacacaatgccccggg
gccgagtctgaggaccaggccatgttgagtagagaggcctggacagtctcagacagggag
ggggctgatagcctaggagttcagggaacagaatacgggtcagacccaggagacaacttc
ccaggaactactgggagagtctgggtcctagaagaggctgacaagggagaccagcaggat
gaggtcgacgagaagagagaggctgaagttaggtttccgatccagaccctggaggctgag
agaactggagagatgactgaaggccacatagctgaagaggaggctatgggagaacaggaa
acagagggcagctttgaggatgaggagaggcaagacttagccatcagggataatggagtg
agtctagaagaagaggtacgggcagaagaatcctccagggagaaaaggaactcctgggcc
acagagcctacgctagtcctagacacggaggctaaagatgaacctgactgggaagactct
ccagaagtcagcactgaggagttgtttgtgggagagaggagtgaagccgcccagatgaca
ccagaggtattgagagtaaaggtcactgaaggacaggaccctgagctggtgagacattcc
caggctttaactaaacaacttgaggaaggacagaagggtcaggaagagactagtggagct
ccagacctgagcccagagcgggtgctaagcttgaaggaatatcctgggcctgtggggttt
gcaggccctgagctagaagcctggggaaactggagtaggggtgtggaccgcagaaatagc
caggaggtaaaagcagatgctgaagcaggcaaggaacagactgcaaccgagcaggcagtg
gagatccgggctgaaggaggccaggaggcccaacagccagaggtcttcgggtcaggagga
gaggaggcactgacctccgtagcacttaacccggagctggagggaagccaaggagcagag
gcggggacagaagagtcagtggaggaatccaagcccacagaaaacgaggctgctgaggag
gaggctgtagtgccttgggaggcagatggaacttgcaggaagaggaggctggaggaggtg
actctgagcctgcaagacagtgaggacacagagaccagttatttggctgaggagattatt
gtgggtatcagggccgtggataccgaggaagggccaaaatgggaagctgggttggctcca
gaaacagagcttgggaaagcctggtgttccgagggcagaggggaggctgggagaggcacg
gagctggaggagactacagagaagcaaagtggacaggaagttggcttggtgggctcagca
gagaaggtgtctggctatgatatccaagaaattgatgggactgaagagggggagcaggca
gagatggagacatctgtaatggcagaagacataagggggacggatggtgtgactttaggc
tcccaggcagagagagcagaggggtccataacccccatggagactgaggggctcctaaga
gatcagatgctgttggaagaagaggctgggggagggcagtcgcgagagcagaaggtccac
aactcagagggcgagatccaaacgctggacgactcttcagaccaggaggggcagcagaca
caccaaatccccacagtagctgtgcctgggcccttggaatcggctgaggccacggcaggt
gccccaggggatgttcacagcaactggaatgaggccctgctccctgggtcccgcctggat
gtctctgtccctcggagtcgtgtgctcctctctcgaagctcctcacggcggcgctcgagg
ccctctttccatcgaatctctgttcctgagccacagtgtgaccctcccagcccccaaccc
caggcggagcggccggtccctgagcaatcctctcttcagctagaggaaactccagagcta
agtgccacaaagcccgaggggactccagtgccagccagaagaaaaatgctggggcgtggg
tttggctttgctcatcctggcatgatgcaggagctgcaagcccgactgagccagccaaag
ccacagtga

DBGET integrated database retrieval system