KEGG   Mus musculus (house mouse): 17151
Entry
17151             CDS       T01002                                 
Symbol
Ccndbp1, DIP1, GCIP, Maid, SECC-8, SSEC-8
Name
(RefSeq) cyclin D-type binding-protein 1
  KO
K21626  cyclin-D1-binding protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17151 (Ccndbp1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    17151 (Ccndbp1)
SSDB
Motif
Pfam: GCIP
Other DBs
NCBI-GeneID: 17151
NCBI-ProteinID: NP_034891
MGI: 109595
Ensembl: ENSMUSG00000023572
UniProt: Q3TVC7
Position
2:120838888..120847393
AA seq 356 aa
MASSTAAVPFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAAVKV
NGEATVLTTHFSKLPWPSPQETQRICEQVRIAIEEIIIVYYSLPKDQGITLRKLVRNAAL
DIVDGMAQLLEVLLTAPSQSTENGDLISCNSVSVACQQVPEIPKDNKAAALLMLTKSVDF
VKDAHEEMEQAVEECDPYSGLLNDSEDNSDSHSDEDGVLGLPSNRDSYWSEEDQELIIPC
LALVRASRASLKKIRILVAENGKKDEVAQLDDIVDISDEISPSVDDLVLSIYPPVCHLTV
RISSAKLVSVLIKALEITKASHVSPHPGDSWIPLLINAVDHCMNRIKALTQRAAEL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgagctcgacagccgcagtccccttccttgctccgcctctggagcagctccggcac
ttagcagaggagctacggtcacttctgcctcgagtacgggtcggcgaagcccaggagaca
gcggaggaatttaatcgagaaatgttttggagaagactcaatgaggcagcagtgaaagtg
aacggggaagccactgttctgacaacgcacttctctaaacttccatggccatctccacag
gaaacccagaggatctgtgagcaagtccgtattgccatcgaggaaataattatagtgtat
tattcacttcctaaggaccagggaatcaccctgagaaagctggtacggaatgctgccctg
gacatcgtggacggcatggctcagctcctggaagtgcttcttactgctccatctcagagc
actgagaatggtgacctgatttcctgcaatagtgtctcagtcgcatgtcaacaggtgcct
gagatcccaaaagataacaaagccgcagcccttttgatgctgaccaagagtgtggatttt
gtgaaagatgcacatgaagaaatggagcaggctgtagaagaatgtgacccgtacagcggc
ctcttgaatgattctgaagacaactccgacagccacagtgatgaggatggtgtgttaggg
cttcccagcaatcgggactcatactggtcagaggaagatcaagaactcataatcccgtgc
ctggcgctggtgagagcatcccgagcttcactcaagaaaatccggatcttggtggctgag
aatggaaagaaggatgaggtggcccagctggatgacattgtggacatttctgatgagatc
agccccagtgtggatgacttggttctgagcatatacccacctgtgtgccacctcactgtg
cggatcagttctgcgaaattggtgtctgttttaataaaggctcttgaaattacaaaagca
agtcacgtgagcccccacccaggagatagctggattcctttactcattaatgccgttgac
cattgcatgaacagaattaaggcgctcactcagcgtgcagctgaactgtga

DBGET integrated database retrieval system