KEGG   Mus musculus (mouse): 17152Help
Entry
17152             CDS       T01002                                 

Gene name
Mak, A930010O05Rik
Definition
(RefSeq) male germ cell-associated kinase
  KO
K08829  male germ cell-associated kinase [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17152 (Mak)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     17152 (Mak)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   17152 (Mak)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Anoct_dimer Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 17152
NCBI-ProteinID: NP_032573
MGI: 96913
Ensembl: ENSMUSG00000021363
UniProt: Q04859
Position
13 A3.3; 13 20.25 cM
AA seq 622 aa AA seqDB search
MNRYTTMKQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFVFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSP
IDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQ
CIPINLKTLIPNASSEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGSSAHHLDTK
QTLHKQLQPLEPKPSSSERDPKPLPNILDQPAGQPQPKQGHQPLQTIQPPQNTVTHPPPK
QQGHQKPPQTMFPSIIKTIPVNSVSTLGHKGARRRWGQTVFKSGDSCDDIEDDLGASHSK
KPSMEACKEKKKESPFRFPDSGLPVSNHFKGENRNLHASVSLKSDPNLSTASTAKQYYLK
QSRYLPGVNPKNVSLVAGGKDINSHSWNNQLFPKSLGSMGADLSFKRSNAAGNLGSYTTY
NQTGYMPSFLKKEVGSAGQRIQLAPLGASASDYTWSTKTGRGQFSGRTYNPTAKNLNIVN
RTQPVPSVHGRTDWVAKYGGHR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatacacaaccatgaagcagctgggagacggcacgtatgggagtgtactgatg
ggcaagagcaatgagtctggggagctggtggcaatcaagaggatgaagagaaagttctat
tcttgggatgagtgtatgaacttgcgagaagttaagtccctgaaaaaactcaatcacgcc
aatgtgattaaactaaaagaagttatcagagagaatgaccatctttattttgtatttgaa
tatatgaaagaaaacctctatcagctaatgaaagacagaaacaaactgttccctgagtca
gtcatcagaaatattatgtatcagatactacaggggctggcatttatccataaacacggc
ttttttcacagggacatgaaacctgagaacttgctctgcatgggcccagagctggtgaag
attgctgattttggacttgcaagagaattaagatcacagccaccatatactgactatgtg
tctaccagatggtaccgggctcctgaagtcttactaaggtcttcggtgtacagctctccc
attgacgtgtgggccgtgggaagtataatggccgagttatatacatttaggccgcttttc
ccagggacaagtgaagttgatgagatctttaaaatctgccaagtgttagggactcccaag
aagagtgactggccggaaggataccagcttgcatcctccatgaacttccgctttccccag
tgcattcccatcaacctaaaaactctcattcccaatgccagtagcgaggccatccagctc
atgacagagatgctgaactgggatccaaagaagcgaccaacagcaagccaggcactgaaa
cacccatatttccaagtcggtcaggtactgggctcttctgcacaccatctggatacaaaa
cagactttacacaagcagctgcagcctctggagccaaagccatcttcctctgaacgggat
cctaagcctttgccaaacatacttgatcagcctgccgggcagccccagccaaaacagggc
caccaaccactgcagaccattcagccaccacagaacacagtgactcacccacccccaaag
cagcagggtcaccagaaaccaccacaaaccatgtttccaagtatcatcaaaaccatccca
gtgaattcagtcagcaccctgggccataagggagcccggagacggtggggtcagacagtc
ttcaagtctggagacagctgtgacgacattgaggacgacttaggagcctcccactccaag
aagccaagcatggaagcctgcaaggagaagaagaaggagtctccatttcggtttccagat
tcaggactcccagtctccaatcactttaagggggaaaataggaatttacatgcatctgtt
tccttaaaatctgatccaaacttgtcaactgcttcaacggctaagcagtactatttgaaa
caatcaagataccttccaggtgtgaaccccaagaatgtgtctttggtagctggaggcaag
gatataaattcacactcttggaataatcagctatttcctaagtcgctgggatccatgggg
gcggacctttccttcaagaggagtaacgcagcaggaaaccttgggagctacaccacttac
aaccagacgggatacatgccttcctttctcaagaaagaagtgggatcagctggccagagg
atccaattggcacctttaggtgcgtcggcttcggactatacctggagcacaaaaactgga
cgaggccagttttcgggacgaacttacaaccccacagccaaaaatctcaatattgtgaac
cgcacacagccagtcccctcggtacacgggaggacagactgggtggctaagtatggaggc
caccggtag

DBGET integrated database retrieval system