KEGG   Mus musculus (mouse): 17155
Entry
17155             CDS       T01002                                 

Gene name
Man1a, Man1a1, PC, PCR1
Definition
(RefSeq) mannosidase 1, alpha
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    17155 (Man1a)
   00513 Various types of N-glycan biosynthesis
    17155 (Man1a)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    17155 (Man1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17155 (Man1a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     17155 (Man1a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    17155 (Man1a)
SSDB
Motif
Pfam: Glyco_hydro_47 DnaB_bind
Other DBs
NCBI-GeneID: 17155
NCBI-ProteinID: NP_032574
MGI: 104677
Ensembl: ENSMUSG00000003746
Vega: OTTMUSG00000024597
UniProt: P45700 Q544T7
Structure
PDB: 
1NXC 5KKB

Position
10; 10 B3
AA seq 655 aa
MPVGGLLPLFSSPGGGGLGSGLGGGLGGGRKGSGPAAFRLTEKFVLLLVFSAFITLCFGA
IFFLPDSSKLLSGVLFHSNPALQPPAEHKPGLGARAEDAAEGRVRHREEGAPGDPGAGLE
DNLARIRENHERALREAKETLQKLPEEIQRDILLEKEKVAQDQLRDKDLFRGLPKVDFLP
PVGVENREPADATIREKRAKIKEMMTHAWNNYKRYAWGLNELKPISKEGHSSSLFGNIKG
ATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGE
EIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFM
HLSHLSGDPVFAEKVMKIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEY
LLKAWLMSDKTDLEAKKMYFDAVQAIETHLIRKSSGGLTYIAEWKGGLLEHKMGHLTCFA
GGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQN
EKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESY
DDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPILREQKKEIDGKEK
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgcccgtggggggcctgttgccgctcttcagtagccctgggggcggcggcctgggcagt
ggcctgggcggggggcttggcggcgggaggaaggggtctggccccgctgccttccgcctc
accgagaagttcgtgctgctgctggtgttcagcgccttcatcacgctctgcttcggggca
atcttcttcctgcctgactcctccaagctgctcagcggggtcctgttccactccaaccct
gccttgcagccgccggcggagcacaagcccgggctcggggcgcgtgcggaggatgccgcc
gaggggagagtccggcaccgcgaggaaggcgcgcctggggaccctggagctggactggaa
gacaacttagccaggatccgcgaaaaccacgagcgggctctcagggaagccaaggagacc
ctgcagaagctgccggaggagatccaaagagacattctgctggagaaggaaaaggtggcc
caggaccagctgcgtgacaaggatctgtttaggggcttgcccaaggtggacttcctgccc
cccgtcggggtagagaaccgggagcccgctgacgccaccatccgtgagaagagggcaaag
atcaaagagatgatgacccatgcttggaataattataaacgctatgcgtggggcttgaac
gaactgaaacctatatcaaaagaaggccattcaagcagtttgtttggcaacatcaaagga
gctacaatagtagatgccctggatacccttttcattatgggcatgaagactgaatttcaa
gaagctaaatcgtggattaaaaaatatttagattttaatgtgaatgctgaagtttctgtt
tttgaagtcaacatacgcttcgtcggtggactgctgtcagcctactatttgtccggagag
gagatatttcgaaagaaagcagtggaacttggggtaaaattgctacctgcatttcatact
ccctctggaataccttgggcattgctgaatatgaaaagtgggatcgggcggaactggccc
tgggcctctggaggcagcagtatcctggccgaatttggaactctgcatttagagtttatg
cacttgtcccacttatcaggagacccagtctttgccgaaaaggttatgaaaattcgaaca
gtgttgaacaaactggacaaaccagaaggcctttatcctaactatctgaaccccagtagt
ggacagtggggtcaacatcatgtgtcggttggaggacttggagacagcttttatgaatat
ttgcttaaggcgtggttaatgtctgacaagacagatctcgaagccaagaagatgtatttt
gatgctgttcaggccatcgagactcacttgatccgcaagtcaagtgggggactaacgtac
atcgcagagtggaaggggggcctcctggaacacaagatgggccacctgacgtgctttgca
ggaggcatgtttgcacttggggcagatggagctccggaagcccgggcccaacactacctt
gaactcggagctgaaattgcccgcacttgtcatgaatcttataatcgtacatatgtgaag
ttgggaccggaagcgtttcgatttgatggcggtgtggaagctattgccacgaggcaaaat
gaaaagtattacatcttacggcccgaggtcatcgagacatacatgtacatgtggcgactg
actcacgaccccaagtacaggacctgggcctgggaagccgtggaggctctagaaagtcac
tgcagagtgaacggaggctactcaggcttacgggatgtttacattgcccgtgagagttat
gacgatgtccagcaaagtttcttcctggcagagacactgaagtatttgtacttgatattt
tccgatgatgaccttcttccactagaacactggatcttcaacaccgaggctcatcctttc
cctatactccgtgaacagaagaaggaaattgatggcaaagagaaatga

KEGG   Mus musculus (mouse): 17156
Entry
17156             CDS       T01002                                 

Gene name
Man1a2, AI428775, AI528764, AI854422, Man, Man1b, PCR2
Definition
(RefSeq) mannosidase, alpha, class 1A, member 2
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    17156 (Man1a2)
   00513 Various types of N-glycan biosynthesis
    17156 (Man1a2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    17156 (Man1a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17156 (Man1a2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     17156 (Man1a2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    17156 (Man1a2)
SSDB
Motif
Pfam: Glyco_hydro_47 DUF1525 Phasin
Other DBs
NCBI-GeneID: 17156
NCBI-ProteinID: NP_034893
MGI: 104676
Ensembl: ENSMUSG00000008763
Vega: OTTMUSG00000007027
UniProt: P39098
Position
3; 3 F2.2
AA seq 641 aa
MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLRKSREEIRAEIQTEKNKVAQAMKTKETRVLPPVPVPQRVGVSGGDPEDMEIKKK
RDKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSTNIFGSSQMGATIVDALDTLYIMGLH
DEFMDGQRWIEENLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKTKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLSYLTGDLTYYNKVM
HIRKLLQKMERPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
RMYDDAVEAIEKHLIKKSRGGLVFIGEWKNGHLERKMGHLACFAGGMFALGADGSRKDKA
GHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWY
LWRFTHDPRYRQWGWEAALAIEKSCRVSGGFSGVKDVYAPTPVHDDVQQSFFLAETLKYL
YLLFSGDDLLPLDHWVFNTEAHPLPVLRLANSTLSGNPAVR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactaccccagcgctgctgcccctctctggtcgtaggataccacctttgaacctgggg
ccgccctccttcccacatcacagggctaccttgagactctccgagaagtttatccttctc
ctcatccttagtgccttcatcaccctgtgttttggggcattcttcttccttccagactct
tcaaaacacaaacgctttgatctgggcttagaagatgtgttaattcctcacgtagatgcc
ggcaaaggagctaaaaaccccggcgtcttcctgatccatggacccgacgaacacagacac
agggaagaagaagagcgtctgagaaataagattagagctgaccatgagaaagccctggaa
gaagcaaaagaaaaattaagaaagtcaagagaggaaatccgtgcagaaattcagacagag
aaaaacaaagtagcccaagcaatgaagacaaaagagaccagggtactgccgcctgtccct
gtcccacaacgtgtaggggtcagtggtggggatccagaagacatggagatcaagaagaaa
agagacaaaattaaagagatgatgaaacatgcctgggataattacagaacatacggatgg
ggacataatgaactaaggcctattgcaaggaaaggccattccactaacatattcggaagc
tcacagatgggtgccaccatagtggatgctttggataccctttatatcatggggcttcat
gatgaattcatggatgggcaaagatggattgaagaaaaccttgatttcagtgtgaattca
gaagtgtctgtctttgaagttaacattcgctttattggagggctcctcgctgcatattac
ctgtcaggagaggaaatattcaagactaaagcagtgcagttggctgagaaactccttcct
gcctttaacacacctactgggattccctgggcaatggtgaacctgaaaagtggagtaggt
cgaaactggggctgggcgtctgcaggcagcagcatcctggctgagttcggcaccctgcac
atggagtttgtgcacctcagctacttgaccggtgacttgacttactataataaggtcatg
cacattcggaaactactgcagaaaatggaacgcccaaatggtctttatccaaattattta
aacccaagaacagggcgctggggtcagtatcacacatcagttggtggtctgggagatagt
ttttatgaatacttactgaaagcatggctgatgtcagataaaacagaccacgaggcaaga
aggatgtatgacgatgctgttgaggctatagaaaaacatcttattaagaagtcccgagga
ggtctggtttttattggagaatggaagaatggacacttggaaaggaagatggggcacttg
gcctgctttgctgggggaatgtttgcccttggagcagatggttccagaaaggataaagct
ggccactacttagaactaggggcagaaattgcacgaacatgtcatgagtcatatgacaga
actgcattgaaactaggtccggagtcattcaagtttgatggtgcagtggaagccgtggct
gtgcggcaggctgaaaagtattacatccttcgtccagaagtaattgaaacctattggtat
ctatggcgatttacccacgacccaagatacaggcagtggggctgggaagcagcactggct
attgagaagtcgtgccgggtcagcggtgggttttctggtgtcaaggatgtatacgccccg
acccctgtgcatgacgacgtgcagcagagcttttttcttgctgaaacattaaaatacttg
tacctgctgttctctggcgatgaccttctacctttagaccactgggtgtttaacacagag
gcgcaccctctgccggtgttgcgcttagccaacagcactctttcaggtaatcctgctgtc
cgatga

KEGG   Mus musculus (mouse): 227619
Entry
227619            CDS       T01002                                 

Gene name
Man1b1, E430019H13Rik, ERMan1, Gm108, MAN, MANA-ER
Definition
(RefSeq) mannosidase, alpha, class 1B, member 1
  KO
K23741  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase [EC:3.2.1.209]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    227619 (Man1b1)
   00513 Various types of N-glycan biosynthesis
    227619 (Man1b1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    227619 (Man1b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    227619 (Man1b1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.209  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase
     227619 (Man1b1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    227619 (Man1b1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 227619
NCBI-ProteinID: NP_001025154
MGI: 2684954
Ensembl: ENSMUSG00000036646
Vega: OTTMUSG00000011996
UniProt: A2AJ15
Position
2; 2 A3
AA seq 658 aa
MYPPPAPPPAPHRDFISVTLSLGESYDNSKSRRRRSCWRKWKQLSRLQRNVILFVLGFLI
LCGFLYSLHTADQWKALSGRPAEVEKMKQEVLPVLPAPQKESAEQEGFADILSQKRQRHF
RRGPPHLQIRPPNTVSKDGMQDDAKEREAALGKAQQEENTQRTVISWRGAVIEPEQATEL
PYKRAEASIKPLVLASKIWKEPAPPNERQKGVIEAFLHAWKGYQKFAWGHDELKPVSKTF
SEWFGLGLTLIDALDTMWILGLKQEFKQARKWVSENLDFQKNVDVNLFESTIRILGGLLS
TYHLSGDSLFLTKAEDFGKRLMPAFTTPSKIPYSDVNIGTGFAHSPQWTSDSTVAEVTSI
QLEFRELSRLTGIKKFQEAVEEVTKHIHSLSGKKDGLVPMFINTNSGLFTHPGVFTLGAR
ADSYYEYLLKQWIQGGKKETQLLEDYVKAIEGIKAHLLRQSQPRKLTFVGELAHGRFSAK
MDHLVCFLPGTLALGVHHGLPADHMDLARALMETCYQMNQQMETGLSPEIAHFNMYPRAD
HKDVEVKPADRHNLLRPETVESLFYLYRVTRDRKYQDWGWEILQSFNKYTRVPSGGYSSI
NNVQNSHKPEPRDKMESFFVGETLKYLYLLFSDDLELLSLDSCVFNTEAHPLPIWAPA
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgtacccaccgccggcgccgccgccggcgcctcaccgggacttcatctcggtgacgctg
agcctgggcgagagctacgacaacagcaagagccggcggcggcgctcatgctggaggaaa
tggaagcagctttcgaggctacagcggaatgtgattctcttcgtcttgggctttctgatt
ctctgtggattcctgtactctcttcatacggctgaccagtggaaagctctgagtggcaga
cctgcagaagtagagaagatgaagcaagaagtcctgcctgtcttaccagcgcctcagaag
gaaagtgctgaacaagaagggtttgcagacatactctctcagaagcggcaaaggcatttt
cggcggggccctccccatctgcagattagaccccccaacacagtctccaaggatgggatg
caggatgatgctaaggagagagaagcagccctggggaaggctcagcaggaagaaaacaca
cagagaaccgtcatcagctggcggggagccgtgattgagcctgaacaggccactgaactt
ccttacaaaagagctgaagcctccatcaaacctctggttttggcatccaagatatggaaa
gagccagcccccccgaatgagcgccagaagggagtgattgaggcctttctccatgcttgg
aagggttaccaaaagtttgcttggggccatgatgaactaaaacctgtgtccaaaaccttc
agtgagtggtttggcctgggcctcaccctgatcgatgccttggataccatgtggattttg
ggtctgaagcaagaatttaagcaagccaggaaatgggtatcagagaacttagactttcag
aagaatgttgatgtcaacctgtttgagagcaccattcgcatcttagggggcctgctgagt
acctaccacctgtcgggggacagcctcttcctgaccaaagctgaagattttggaaaacgg
ctgatgcctgccttcactacgccctccaagatcccatactctgatgtgaacattggcact
ggatttgcccactcaccccagtggacttcagacagcacggtggcagaagtgacgagcatt
cagttggagttccgggagctctctcgtcttactggaataaagaaattccaggaggccgtg
gaggaagtgacaaagcacatccactccctgtctgggaagaaagacgggctggtgcctatg
ttcatcaacacgaacagcggcctcttcacccacccaggagtgttcaccttgggggccagg
gctgacagctactacgaatacctgctgaaacagtggatccagggtggcaagaaggagaca
cagttgctggaagactatgttaaagccattgaggggataaaagcccatctgctccggcag
tctcagcccagaaagctcaccttcgtgggagaacttgcccacggccgcttcagtgccaag
atggaccacttagtgtgcttcctgccggggacgctggctttgggtgtccaccatggcctg
ccagctgaccacatggatctagctcgggccctcatggagacctgctaccagatgaaccaa
cagatggagacaggtctgagccctgagattgcacatttcaacatgtaccctcgggcagat
cataaagatgtggaggtcaagccagctgacaggcacaacctgctgcggccagagacggtg
gaaagcctattctatctgtaccgtgtcacaagggaccgcaagtaccaggactggggctgg
gaaatcctgcagagcttcaataagtacacacgggtcccctcaggtggctattcttctatc
aacaacgtccagaattcccacaagcctgagcccagggacaagatggagagcttctttgtg
ggggaaaccctgaagtacttgtacctgctcttttctgatgacctggagctgctcagtctg
gacagctgtgtgttcaacacagaagcccatcccctccccatctgggctcctgcgtag

KEGG   Mus musculus (mouse): 230815
Entry
230815            CDS       T01002                                 

Gene name
Man1c1, AI593348
Definition
(RefSeq) mannosidase, alpha, class 1C, member 1
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    230815 (Man1c1)
   00513 Various types of N-glycan biosynthesis
    230815 (Man1c1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    230815 (Man1c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    230815 (Man1c1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     230815 (Man1c1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    230815 (Man1c1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 230815
NCBI-ProteinID: NP_997120
MGI: 2446214
Ensembl: ENSMUSG00000037306
Vega: OTTMUSG00000011212
UniProt: Q6NXK9
Position
4; 4 D3
AA seq 625 aa
MLVRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFSASRTQQ
PGLEVMAEIAGHHSVSEQEPPPNPAPAAPAPGEDDPSRLVGVLRRKGWLRRTRPTGPREE
GNRVAALRPQEESVRFTFDYNGFRSRLRHPVLGTRTDESKESQSLVRAQREKIKEMMRFS
WQNYRRYAMGKNELRPLTKDGFEGSMFGGLSGATIIDSLDTLYLMELKEEFQEAKAWVQD
SFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRVKAIKLGEKLLPAFNTPTGIPKGV
VNFKSGSWGWATAGSSSILAEFGSLHLEFLHLTELSGNPVFAEKVKHIRKVLREIDKPFG
LYPNFLSPTSGNWVQHHVSVGGLGDSFYEYLIKSWLMSAKTDMEAKNMYYEALEAIETYL
VNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGADDAKEDKRAYYRELAAQITRTC
HESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHDPIYREWG
WEVVMALEKHCRTEAGFSGIQDVYSSNPNHDNRQQSFFLAETLKYLYLLFSEDNVLSLED
WVFNTEAHPLPVNRSDSFSIAGHPH
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgctggtgaggaaagtgccgggtttcgtcccggcctcgccgtgggggctgcggctgccg
cagaagttccttttcctgctcttcctctcgggcctcgtcaccctgtgctttggcgccctg
ttccttctgccccattcctctcgcctcaagcgcctcttctcggcctcgcggacccaacag
cccggcctggaggtgatggccgaaatcgccggtcaccactcggtgtcagagcaggagccg
cctcccaaccctgcccctgcggctccggccccgggtgaggacgatcccagccgcctggtc
ggtgttctccgtaggaaagggtggctgcggcgaacccgccccaccgggccccgggaggaa
ggcaacagggttgcagccctcaggccgcaggaagagagcgtccggttcactttcgactac
aatggtttccgcagccgccttcgacacccggtcttggggacaaggactgatgagagtaag
gagtcccagagtctggtgcgagctcagcgagagaaaatcaaagagatgatgcggttttcc
tggcagaattaccgccgttatgcgatgggcaagaatgagctccggccactcacaaaggac
ggcttcgagggcagcatgtttggcggtctcagtggggctaccatcatcgattctcttgac
accctctacctcatggagctgaaagaggagttccaggaggccaaggcctgggtgcaagac
agcttccacctgaacgtgagtggagaagcatctttgtttgaagtgaacatccggtatatc
ggaggactgctctcggccttctacctgactggagaagaggtgttccgagtgaaggccatc
aagctgggtgagaaactgctgcctgccttcaacacacccacgggcatccccaagggcgtg
gtcaacttcaaaagcggtagctggggctgggccacggcaggcagcagcagcatcctggcc
gagtttgggtccctgcacttggaattcctgcatctcactgaactctctggcaatccagtc
tttgcagaaaaggtcaaacatatccgcaaggtcctcagggagattgacaaacccttcggt
ctctaccccaacttcctcagccccacgagtggaaactgggtgcagcatcatgtctcggta
ggaggacttggggacagtttttatgaatatttgatcaagtcctggttgatgtcagccaaa
acagatatggaggctaaaaatatgtactacgaagccttggaggccatagagacctatctc
gtgaatgtctctcccgggggcctgacctacattgctgagtggcgtggaggaattctggac
cacaagatgggacaccttgcctgcttctcagggggcatgatcgcccttggtgcagatgat
gccaaggaagataaaagagcctactaccgagagcttgcagcccagatcaccaggacgtgc
catgagtcctatgcccgctcagacaccaagctggggcctgaggccttctggttcaactct
ggccgagaggcggtggccacacaactgagcgagagctactacatcctgcgccccgaggtg
gtagagagctacatgtacctatggcggcagacgcatgaccccatctacagggagtggggc
tgggaggtggtcatggccctggagaaacactgtcggacggaagccggcttctcggggatc
caggacgtgtacagcagtaaccccaaccatgacaacaggcaacagagcttcttcctggct
gagacgctgaaatacctctatcttctgttctctgaagataacgtgctgtcactggaagac
tgggtgttcaacaccgaggctcatccgctgcccgtcaaccgctcggacagctttagcata
gctggccaccctcactga

DBGET integrated database retrieval system