KEGG   Mus musculus (mouse): 17156
Entry
17156             CDS       T01002                                 

Symbol
Man1a2, AI428775, AI528764, AI854422, Man1b, PCR2
Name
(RefSeq) mannosidase, alpha, class 1A, member 2
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    17156 (Man1a2)
   00513 Various types of N-glycan biosynthesis
    17156 (Man1a2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    17156 (Man1a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17156 (Man1a2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     17156 (Man1a2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    17156 (Man1a2)
SSDB
Motif
Pfam: Glyco_hydro_47 DUF1525 Phasin
Other DBs
NCBI-GeneID: 17156
NCBI-ProteinID: NP_034893
MGI: 104676
Ensembl: ENSMUSG00000008763
Vega: OTTMUSG00000007027
UniProt: P39098
Position
3; 3 F2.2
AA seq 641 aa
MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLRKSREEIRAEIQTEKNKVAQAMKTKETRVLPPVPVPQRVGVSGGDPEDMEIKKK
RDKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSTNIFGSSQMGATIVDALDTLYIMGLH
DEFMDGQRWIEENLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKTKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLSYLTGDLTYYNKVM
HIRKLLQKMERPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
RMYDDAVEAIEKHLIKKSRGGLVFIGEWKNGHLERKMGHLACFAGGMFALGADGSRKDKA
GHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWY
LWRFTHDPRYRQWGWEAALAIEKSCRVSGGFSGVKDVYAPTPVHDDVQQSFFLAETLKYL
YLLFSGDDLLPLDHWVFNTEAHPLPVLRLANSTLSGNPAVR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactaccccagcgctgctgcccctctctggtcgtaggataccacctttgaacctgggg
ccgccctccttcccacatcacagggctaccttgagactctccgagaagtttatccttctc
ctcatccttagtgccttcatcaccctgtgttttggggcattcttcttccttccagactct
tcaaaacacaaacgctttgatctgggcttagaagatgtgttaattcctcacgtagatgcc
ggcaaaggagctaaaaaccccggcgtcttcctgatccatggacccgacgaacacagacac
agggaagaagaagagcgtctgagaaataagattagagctgaccatgagaaagccctggaa
gaagcaaaagaaaaattaagaaagtcaagagaggaaatccgtgcagaaattcagacagag
aaaaacaaagtagcccaagcaatgaagacaaaagagaccagggtactgccgcctgtccct
gtcccacaacgtgtaggggtcagtggtggggatccagaagacatggagatcaagaagaaa
agagacaaaattaaagagatgatgaaacatgcctgggataattacagaacatacggatgg
ggacataatgaactaaggcctattgcaaggaaaggccattccactaacatattcggaagc
tcacagatgggtgccaccatagtggatgctttggataccctttatatcatggggcttcat
gatgaattcatggatgggcaaagatggattgaagaaaaccttgatttcagtgtgaattca
gaagtgtctgtctttgaagttaacattcgctttattggagggctcctcgctgcatattac
ctgtcaggagaggaaatattcaagactaaagcagtgcagttggctgagaaactccttcct
gcctttaacacacctactgggattccctgggcaatggtgaacctgaaaagtggagtaggt
cgaaactggggctgggcgtctgcaggcagcagcatcctggctgagttcggcaccctgcac
atggagtttgtgcacctcagctacttgaccggtgacttgacttactataataaggtcatg
cacattcggaaactactgcagaaaatggaacgcccaaatggtctttatccaaattattta
aacccaagaacagggcgctggggtcagtatcacacatcagttggtggtctgggagatagt
ttttatgaatacttactgaaagcatggctgatgtcagataaaacagaccacgaggcaaga
aggatgtatgacgatgctgttgaggctatagaaaaacatcttattaagaagtcccgagga
ggtctggtttttattggagaatggaagaatggacacttggaaaggaagatggggcacttg
gcctgctttgctgggggaatgtttgcccttggagcagatggttccagaaaggataaagct
ggccactacttagaactaggggcagaaattgcacgaacatgtcatgagtcatatgacaga
actgcattgaaactaggtccggagtcattcaagtttgatggtgcagtggaagccgtggct
gtgcggcaggctgaaaagtattacatccttcgtccagaagtaattgaaacctattggtat
ctatggcgatttacccacgacccaagatacaggcagtggggctgggaagcagcactggct
attgagaagtcgtgccgggtcagcggtgggttttctggtgtcaaggatgtatacgccccg
acccctgtgcatgacgacgtgcagcagagcttttttcttgctgaaacattaaaatacttg
tacctgctgttctctggcgatgaccttctacctttagaccactgggtgtttaacacagag
gcgcaccctctgccggtgttgcgcttagccaacagcactctttcaggtaatcctgctgtc
cgatga

DBGET integrated database retrieval system