KEGG   Mus musculus (mouse): 17159Help
Entry
17159             CDS       T01002                                 

Gene name
Man2b1, AW107687, LAMAN
Definition
(RefSeq) mannosidase 2, alpha B1
  KO
K12311  lysosomal alpha-mannosidase [EC:3.2.1.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    17159 (Man2b1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    17159 (Man2b1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     17159 (Man2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Motif
Other DBs
NCBI-GeneID: 17159
NCBI-ProteinID: NP_034894
MGI: 107286
Ensembl: ENSMUSG00000005142
Vega: OTTMUSG00000061404
UniProt: O09159
Position
8 C3; 8 41.55 cM
AA seq 1013 aa AA seqDB search
MGTGPLTSGVRAGGGNTGWLWMSSCNLGSPVLPISFLFWLLLAAPGARAAGYKTCPPTKP
GMLNVHLLPHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVE
MAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQ
DTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRKKKLRMEELWR
ASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNPRSPEFNAKTLVNYFLKLA
SSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYL
WELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
PEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVLVSNAL
ARLSHYKQNFSFCRELNISICPVSQTSERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDP
HDKNISSNVVMVPSYYSETYQWELLFPASVPALGFSTYSVAKMSDLNHQAHNLLSRPRKH
KSHHVLVIENKYMRATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDEESSQASGA
YIFRPNVGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPI
PVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVN
TRIYITDGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLETDTGDKVR
GRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSGLRQELPPQ
VHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAAN
QPLSRASRLKWMTNTGPTSYPEPSKLDPTSVTLKPMEIRTFLASVQWQEHRPA
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccggaccgctcacctctggtgtccgtgctggtggcgggaacaccgggtggctc
tggatgagctcctgcaacctaggttcgccagtcctgcctatttcctttcttttttggctg
ttgctggccgcgcctggcgctcgggccgcgggttacaagacatgtcccccaacgaagcca
ggcatgctcaatgtgcacctgctgcctcatacacacgatgatgtaggctggctgaagaca
gtggaccaatactattacggcatcctgagtgatgttcagcacgcatctgttcagtacatc
ctagactcagtagtctcctctctactggagaaacccacccgtcgcttcatctatgtggaa
atggctttcttctcccgttggtggaagcagcagaccagtgcaacccaggacgctgtacgg
aacctggtgcgccaggggcgcctggagtttgtcaatggtggctgggtgatgaacgacgaa
gcagccacccactatggcgcgattgtggaccagatgacacttgggctacgcttcctgcaa
gacacatttggtagtgatggacttccccgtgtggcctggcatattgaccctttcggccac
tctcgagaacaggcctccctgtttgcccagatgggttttgatggcttcttccttgggcgc
attgactatcaagataaacttaatcggaagaaaaagctgaggatggaggagctgtggaga
gctagtgacagcttggagccccccgctgctgacctctttactggtgtgctccccaataat
tacaaccccccgaaatacctgtgctgggatgtgctatgtacagaccctcccgtggtggat
aatccccggagccctgagttcaatgcaaaaacgttggtcaactacttcctgaagctcgct
tcttcccagaaagggttttaccgaaccaaccacaccgtgatgaccatgggctcagacttc
cattatgagaatgccaacatgtggttcaaaaacatggacaagctgatccgcctggtcaac
gcgcagcaggtaaacgggagcctcgtccacgttctctactccacccctacgtgttacctc
tgggagctgaacaaggccaatctcacctggacagtgaaggaggacgacttctttccttat
gccgatggcccccacatgttctggactggctatttttccagcaggccagccctcaagcgc
tatgagcgcctcagttacaacttcctgcaggtgtgtaaccagctggaagcactggtgggt
cccgaagccaacgtgggaccctatggctcgggagacagcgcacctcttcaggaggcaatg
gcggtgctccaacaccacgacgctgtcagtggtactgcaaggcagaatgttgtaaatgac
tacgcgaggcagctggcagcaggctggggaccctgtgaggttctcgtgagcaacgctctg
gcgcgactcagccattacaaacagaacttctcattctgtcgtgagctcaacattagcatc
tgcccagtcagccagacttcggagcgtttccaggtaactctttacaaccccctggggcga
aaggtggatcagatggttcggctgcctgtctatgaaggcaacttcattgtgaaggaccct
catgataagaacatttccagtaacgtggtgatggttcctagctattacagtgagacttac
caatgggagctgctgttcccagcctcagtgcctgccctgggcttcagcacctactctgtg
gccaaaatgagtgaccttaaccaccaagcccacaacctgctgtccaggcccaggaaacac
aagtcccatcatgtcttagtcattgaaaataagtacatgcgggccacatttgactctggc
acggggttattgatgaagattgaaaacttggaacagaacctctcgctccctgtgagccaa
ggcttcttttggtataatgccagtgttggtgatgaggagagttctcaggcctctggggcc
tacatcttcagacccaatgtcggtaaaccgatacctgtgagccgctgggctcagatcagt
ttggtgaagacagccttggtgcaggaggtacaccagaatttttcagcctggtgttcccaa
gtgattcgcctgtacaaaggacagcgccatttggagctggagtggacggtgggaccaatc
ccagtgagagatgactgggggaaggaagtcatcagccgctttgacaccccaatgaaaacc
aagggacagttcttcacggacagcaacggccgggaaatcctgaagaggagggatgattat
cgacccacctggacattgaatcagactgagccggtggctggaaattactatcctgtcaac
actcgaatttatatcacggatgggcaaatgcagctgaccgtgttgaccgaccgctcccag
gggggcagcagtctgcaggatggctcgttggagctcatggtgcaccgtcggctgttggta
gatgatgatcgtggagtgtcggaacccttgttggagacagataccggggataaggttcga
ggacgccaccttgtgcttttgagttctgtcagtgatgccgctgcaagacaccgactgctg
gcggaacaagaagtcctggcccctcaggtggtgctgtctctgggtggtagcagtccctat
cactcccgggcgacaccaaaaacgcagttttccggacttcgccaggagctacctcctcag
gtgcatttgctcacactggcccgctgggggccaaagatgctgctgctgcgcttggagcac
cagttcgctctgaaagaagattcggatcgcaacctgagctcccctgtaaccttgaacgtt
cagaacctgttccagaccttcactatcaactacctgcaggagaccacactggcagccaac
cagcccctgtccagggcttccaggctcaagtggatgacaaatactggtcccacctcctac
cctgagccttccaagttggaccctacctcagtcacactgaagcctatggaaatacgtacc
ttcctggcctctgtacaatggcaagaacacaggcctgcctga

DBGET integrated database retrieval system