KEGG   Mus musculus (mouse): 17161Help
Entry
17161             CDS       T01002                                 

Gene name
Maoa, 1110061B18Rik, AA407771
Definition
(RefSeq) monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00350  Tyrosine metabolism
mmu00360  Phenylalanine metabolism
mmu00380  Tryptophan metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    17161 (Maoa)
   00330 Arginine and proline metabolism
    17161 (Maoa)
   00340 Histidine metabolism
    17161 (Maoa)
   00350 Tyrosine metabolism
    17161 (Maoa)
   00360 Phenylalanine metabolism
    17161 (Maoa)
   00380 Tryptophan metabolism
    17161 (Maoa)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    17161 (Maoa)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    17161 (Maoa)
   04726 Serotonergic synapse
    17161 (Maoa)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    17161 (Maoa)
   05031 Amphetamine addiction
    17161 (Maoa)
   05034 Alcoholism
    17161 (Maoa)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     17161 (Maoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Thi4 FAD_binding_2 HI0933_like Pyr_redox FAD_binding_3 Pyr_redox_3 FAD_oxidored Lycopene_cycl AlaDh_PNT_C GIDA NAD_binding_9 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 17161
NCBI-ProteinID: NP_776101
MGI: 96915
Ensembl: ENSMUSG00000025037
Vega: OTTMUSG00000016928
UniProt: Q64133 Q3TPD9 Q3UJ53
Position
X A1.2; X 11.78 cM
AA seq 526 aa AA seqDB search
MTDLEKPSITGHMFDVVVIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDDMGKEIPVDAPWQARHAEEWDKITMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTSRIFSVTNGGQERKFVGGSGQISEQIMVLLGDKVKL
SSPVTYIDQTDDNIIIETLNHEHYECKYVISAIPPVLTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSMPAIMGFILARKAER
LAKLHKDIRKRKICELYAKVLGSQEALSPVHYEEKNWCEEQYSGGCYTAYFPPGIMTLYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVQEPESKD
VPALEITHTFLERNLPSVPGLLKITGFSTSVALLCFVLYKFKQPQS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctggagaagcccagtatcacaggccacatgttcgacgtagtcgtgattgga
ggcggcatctcaggattggctgctgccaaactattgtcagaatacaaaattaatgtcttg
gttctggaagcccgggatagagttggaggaagaacatatactgtgaggaatgagcatgtt
aaatgggtagatgttggtggagcttatgtgggaccaacccagaacagaatcttacgcttg
tctaaggagctaggcatagagacctataaagtgaatgtcaatgagcgtctagttcaatat
gtcaaggggaaaacttacccattccgtggtgcatttccacctgtgtggaaccccttggca
tatttggattacaacaacctgtggaggacaatggatgatatgggaaaagagatccctgtt
gatgcaccatggcaagcaagacatgctgaggaatgggacaagataaccatgaaagatctc
attgataaaatctgttggacaaaaactgctcgagaatttgcttatctttttgtgaacatt
aatgtgacttctgagcctcatgaggtatctgccctgtggttcttgtggtatgtgaggcag
tgtggaggtacctctcggatattctcagtcaccaatggcggccaggaacggaaatttgta
ggtggctctggccaaataagtgaacagataatggtcctccttggggataaagtgaagctg
agctctcctgttacttatattgaccaaacagatgacaacatcattatagaaacactgaat
catgagcactatgagtgcaaatatgtaattagtgccatcccaccggttttgactgccaag
atccactttaaaccagagcttccacctgagagaaaccaattaattcagcgtcttccaatg
ggggctgtcatcaagtgcatggtgtattacaaggaagccttctggaagaaaaaggactat
tgtggctgcatgataattgaagatgaggaggctccaatttcaatcactctggatgacact
aaaccagatgggtcaatgcctgccatcatgggcttcatacttgcccggaaagctgaacga
cttgctaaactacataaagacataaggaagaggaaaatctgtgagctgtatgccaaagtt
ctgggatctcaagaagctttatctcccgtccattatgaagagaagaactggtgtgaggag
cagtactccgggggctgctacacagcctacttccctcctggtatcatgactctgtatgga
agggtgattcggcagccagtaggcaggatttactttgcaggcacagagacagcaacacag
tggagtggctacatggaaggtgcagttgaagctggagaacgagcagctagagaggtcttg
aatgctctaggaaaagttgccaagaaggatatatgggttcaagagcctgagtccaaggat
gttccagctcttgaaattacccacaccttcttagagaggaacctgccttccgtgcctggt
ctgctcaagatcactggtttttccacttctgtggctcttctctgctttgtattgtacaag
tttaaacagccccagtcctga

DBGET integrated database retrieval system